OPENSEQ.org - USPG - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

USPG - Universal stress protein G

UniProt:	P39177	Sequence MYKTIIMPVDVFEMELSDKAVRHAEFLAQDDGVIHLLHVLPGSASLSLHRFAADVRRFEEHLQHEAQERLQTMVSHFTIDPSRIKQHVRFGSVRDEVNELAEELGADVVVIGSRNPSISTHLLGSNASSVIRHANLPVLVVR	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12683
Length:	142 (140)
Sequences:	6828
Seq/Len:	48.77

USPG
Paralog alert: 0.76 [within 20: 0.25] - ratio of genomes with paralogs
Cluster includes: USPA USPC USPD USPF USPG

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
4_T	35_H	2.774	1.00
33_V	85_K	2.765	1.00
4_T	33_V	2.603	1.00
35_H	87_H	2.602	1.00
108_V	139_L	2.519	1.00
6_I	106_A	2.423	1.00
94_R	129_S	2.38	1.00
128_S	132_R	2.312	1.00
8_P	111_I	2.292	1.00
101_A	109_V	2.079	1.00
87_H	100_L	2	1.00
111_I	130_V	1.99	1.00
23_H	139_L	1.971	1.00
100_L	104_L	1.922	1.00
35_H	104_L	1.889	1.00
91_G	96_E	1.873	1.00
113_S	142_R	1.833	1.00
35_H	106_A	1.776	1.00
89_R	96_E	1.731	1.00
102_E	135_N	1.71	1.00
7_M	24_A	1.703	1.00
109_V	134_A	1.682	1.00
67_Q	71_Q	1.655	1.00
113_S	140_V	1.653	1.00
96_E	99_E	1.628	1.00
8_P	97_V	1.582	1.00
33_V	83_R	1.578	1.00
24_A	28_A	1.567	1.00
35_H	100_L	1.551	1.00
131_I	140_V	1.529	1.00
37_L	100_L	1.505	1.00
2_Y	23_H	1.43	1.00
74_V	86_Q	1.429	1.00
98_N	133_H	1.417	1.00
22_R	76_H	1.407	0.99
63_Q	67_Q	1.401	0.99
35_H	85_K	1.385	0.99
109_V	136_L	1.372	0.99
37_L	97_V	1.37	0.99
38_H	66_A	1.329	0.99
2_Y	137_P	1.292	0.99
87_H	104_L	1.287	0.99
134_A	138_V	1.276	0.99
12_F	17_S	1.271	0.99
23_H	26_F	1.266	0.99
101_A	135_N	1.266	0.99
39_V	96_E	1.249	0.99
26_F	30_D	1.226	0.98
18_D	76_H	1.213	0.98
74_V	78_T	1.21	0.98
89_R	100_L	1.21	0.98
129_S	133_H	1.209	0.98
24_A	34_I	1.179	0.98
93_V	126_N	1.179	0.98
98_N	130_V	1.174	0.98
4_T	106_A	1.169	0.97
7_M	21_V	1.165	0.97
23_H	137_P	1.149	0.97
4_T	107_D	1.147	0.97
25_E	77_F	1.143	0.97
59_E	63_Q	1.118	0.96
109_V	130_V	1.106	0.96
17_S	20_A	1.103	0.96
21_V	73_M	1.099	0.96
98_N	101_A	1.084	0.96
101_A	106_A	1.084	0.96
99_E	103_E	1.083	0.96
97_V	130_V	1.068	0.95
11_V	73_M	1.065	0.95
127_A	140_V	1.058	0.95
5_I	108_V	1.041	0.94
32_G	107_D	1.032	0.94
118_I	122_L	1.019	0.93
6_I	37_L	1.012	0.93
27_L	110_V	1.008	0.93
73_M	76_H	1.005	0.93
9_V	21_V	1.001	0.92

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
3s3tA	8	0.9789	99.9	0.1	Contact Map	0.69
3olqA	1	0.9859	99.9	0.107	Contact Map	0.755
1mjhA	2	0.9859	99.9	0.108	Contact Map	0.881
3hgmA	4	0.9789	99.9	0.113	Contact Map	0.886
3fdxA	2	0.9789	99.9	0.116	Contact Map	0.749
2dumA	4	0.9718	99.9	0.118	Contact Map	0.792
3fg9A	6	0.9577	99.9	0.131	Contact Map	0.682
1tq8A	6	0.9789	99.9	0.139	Contact Map	0.738
3tnjA	1	0.9648	99.9	0.14	Contact Map	0.773
2gm3A	6	1	99.9	0.144	Contact Map	0.821

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0099 seconds.