OPENSEQ.org - YJFN - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YJFN - Uncharacterized protein YjfN

UniProt:	P0AF82	Sequence MKQLLASPSLQLVTYPASATAQSAEFASADCVTGLNEIGQISVSNISGDPQDVERIVALKADEQGASWYRIITMYEDQQPDNWRVQAILYA	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12521
Length:	91 (91)
Sequences:	365
Seq/Len:	4.01

YJFN
Paralog alert: 0.98 [within 20: 0.46] - ratio of genomes with paralogs
Cluster includes: BHSA MCBA YAHO YBIJ YHCN YJFN YJFY

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
49_D	52_D	2.625	1.00
59_L	63_E	2.453	1.00
17_A	21_A	2.107	1.00
66_A	89_L	2.012	1.00
58_A	62_D	1.742	0.99
18_S	21_A	1.716	0.99
54_E	71_I	1.657	0.99
43_V	53_V	1.579	0.98
50_P	85_V	1.579	0.98
37_E	88_I	1.554	0.98
36_N	70_R	1.532	0.98
7_S	20_T	1.521	0.98
13_V	18_S	1.471	0.97
27_A	32_V	1.435	0.97
55_R	59_L	1.41	0.96
49_D	56_I	1.338	0.94
72_I	86_Q	1.337	0.94
70_R	88_I	1.334	0.94
59_L	62_D	1.318	0.94
51_Q	89_L	1.29	0.93
40_Q	72_I	1.27	0.92
53_V	83_W	1.267	0.92
67_S	91_A	1.259	0.92
25_E	38_I	1.241	0.91
12_L	15_Y	1.186	0.88
81_D	85_V	1.184	0.88
48_G	53_V	1.175	0.88
24_A	27_A	1.174	0.87
58_A	88_I	1.133	0.85
76_E	83_W	1.126	0.84
25_E	28_S	1.114	0.83
4_L	14_T	1.1	0.82
37_E	46_I	1.094	0.82
5_L	11_Q	1.09	0.82
48_G	52_D	1.087	0.81
58_A	89_L	1.083	0.81
5_L	12_L	1.083	0.81
16_P	21_A	1.076	0.80
57_V	85_V	1.074	0.80
17_A	20_T	1.072	0.80
39_G	89_L	1.068	0.80
25_E	29_A	1.008	0.74
38_I	62_D	1.003	0.74

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2jnaA	2	0.9451	99.9	0.125	Contact Map	0.352
2nocA	1	0.9341	99.9	0.125	Contact Map	0.453
2m2jA	1	0.978	99.8	0.261	Contact Map	0.57
4evuA	2	0.7912	99.8	0.283	Contact Map	0.552
2ma4A	1	0.7033	99.8	0.29	Contact Map	0.443
2qgmA	1	0.8462	40.1	0.871	Contact Map	0.024
3b55A	1	0.8462	19.9	0.889	Contact Map	0.025
2jynA	1	0.5495	10.2	0.903	Contact Map	0.26
4kzkA	1	0.9011	6.2	0.912	Contact Map	0.315
3sg0A	1	0.8462	4.4	0.918	Contact Map	0.1

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.032 seconds.