OPENSEQ.org - MCBA - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

MCBA - Uncharacterized protein McbA

UniProt:	P0AAX6	Sequence MKKCLTLLIATVLSGISLTAYAAQPMSNLDSGQLRPAGTVSATGASNLSDLEDKLAEKAREQGAKGYVINSAGGNDQMFGTATIYK	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13318
Length:	86 (86)
Sequences:	376
Seq/Len:	4.37

MCBA
Paralog alert: 0.97 [within 20: 0.47] - ratio of genomes with paralogs
Cluster includes: BHSA MCBA YAHO YBIJ YHCN YJFN YJFY

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
47_N	50_D	2.585	1.00
57_E	61_E	2.152	1.00
74_G	78_M	1.852	1.00
64_A	84_I	1.817	1.00
21_Y	25_P	1.751	0.99
36_P	83_T	1.635	0.99
18_L	22_A	1.582	0.99
4_C	8_L	1.52	0.98
42_A	51_L	1.506	0.98
53_D	57_E	1.443	0.97
47_N	54_K	1.436	0.97
48_L	80_G	1.429	0.97
52_E	69_I	1.407	0.97
56_A	60_R	1.394	0.96
1_M	5_L	1.388	0.96
24_Q	27_S	1.343	0.95
8_L	15_G	1.338	0.95
70_N	81_T	1.302	0.94
51_L	72_A	1.284	0.94
1_M	9_I	1.278	0.93
17_S	21_Y	1.266	0.93
71_S	81_T	1.256	0.93
57_E	60_R	1.246	0.92
65_K	86_K	1.226	0.91
35_R	68_V	1.221	0.91
26_M	31_S	1.22	0.91
19_T	22_A	1.209	0.91
68_V	83_T	1.209	0.91
46_S	51_L	1.201	0.90
69_I	72_A	1.18	0.89
51_L	78_M	1.178	0.89
76_D	80_G	1.132	0.86
26_M	68_V	1.122	0.86
49_S	84_I	1.12	0.86
5_L	11_T	1.11	0.85
56_A	83_T	1.075	0.82
16_I	19_T	1.071	0.82
7_L	12_V	1.069	0.82
51_L	74_G	1.062	0.81
17_S	22_A	1.058	0.81
7_L	20_A	1.043	0.80
55_L	80_G	1.024	0.78
7_L	11_T	1.015	0.77
16_I	86_K	1.009	0.76

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2nocA	1	0.9884	99.9	0.082	Contact Map	0.431
2jnaA	2	0.9884	99.9	0.093	Contact Map	0.378
2m2jA	1	1	99.8	0.254	Contact Map	0.521
2ma4A	1	0.7442	99.8	0.28	Contact Map	0.472
4evuA	2	0.8023	99.8	0.298	Contact Map	0.627
2qgmA	1	0.8605	29.4	0.881	Contact Map	0.026
3b55A	1	0.8605	13	0.9	Contact Map	0.031
4kzkA	1	0.9302	9.4	0.906	Contact Map	0.367
2jynA	1	0.5814	9.1	0.906	Contact Map	0.25
3sg0A	1	0.8837	8.7	0.907	Contact Map	0.085

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0269 seconds.