OPENSEQ.org - BHSA - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

BHSA - Multiple stress resistance protein BhsA

UniProt:	P0AB40	Sequence MKNVKTLIAAAILSSMSFASFAAVEVQSTPEGQQKVGTISANAGTNLGSLEEQLAQKADEMGAKSFRITSVTGPNTLHGTAVIYK	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13436
Length:	85 (85)
Sequences:	370
Seq/Len:	4.35

BHSA
Paralog alert: 0.97 [within 20: 0.48] - ratio of genomes with paralogs
Cluster includes: BHSA MCBA YAHO YBIJ YHCN YJFN YJFY

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
46_N	49_S	2.573	1.00
63_A	83_I	2.026	1.00
56_Q	60_E	1.984	1.00
73_G	77_L	1.853	1.00
18_F	22_A	1.802	1.00
21_F	25_E	1.794	1.00
35_K	82_V	1.739	0.99
41_A	50_L	1.677	0.99
55_A	59_D	1.555	0.98
47_L	79_G	1.536	0.98
1_M	9_A	1.396	0.96
1_M	5_K	1.383	0.96
52_E	56_Q	1.356	0.96
7_L	12_I	1.342	0.95
50_L	71_V	1.341	0.95
8_I	15_S	1.319	0.95
51_E	68_I	1.317	0.95
46_N	53_Q	1.317	0.95
69_T	80_T	1.292	0.94
67_R	82_V	1.282	0.94
34_Q	67_R	1.253	0.93
70_S	80_T	1.243	0.92
19_A	22_A	1.241	0.92
45_T	50_L	1.221	0.91
55_A	82_V	1.205	0.90
75_N	79_G	1.202	0.90
17_S	22_A	1.196	0.90
68_I	71_V	1.187	0.90
4_V	8_I	1.18	0.89
4_V	7_L	1.174	0.89
24_V	27_Q	1.16	0.88
5_K	11_A	1.149	0.87
48_G	83_I	1.142	0.87
50_L	77_L	1.119	0.86
50_L	73_G	1.113	0.85
64_K	85_K	1.105	0.85
17_S	21_F	1.095	0.84
1_M	4_V	1.079	0.83
16_M	19_A	1.059	0.81
26_V	67_R	1.059	0.81
79_G	83_I	1.044	0.80
54_L	79_G	1.014	0.77
14_S	85_K	1.013	0.77

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2nocA	1	0.9882	99.9	0.076	Contact Map	0.393
2jnaA	2	0.9882	99.9	0.096	Contact Map	0.36
2m2jA	1	0.9765	99.8	0.255	Contact Map	0.479
2ma4A	1	0.7412	99.8	0.288	Contact Map	0.472
4evuA	2	0.8	99.8	0.3	Contact Map	0.589
2qgmA	1	0.8588	21.6	0.887	Contact Map	0.022
3b55A	1	0.8588	18.9	0.89	Contact Map	0.023
2jynA	1	0.5882	8.6	0.906	Contact Map	0.199
4kzkA	1	0.9529	6.7	0.91	Contact Map	0.31
3sg0A	1	0.8941	6	0.912	Contact Map	0.078

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0449 seconds.