OPENSEQ.org - USPF - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

USPF - Universal stress protein F

UniProt:	P37903	Sequence MNRTILVPIDISDSELTQRVISHVEEEAKIDDAEVHFLTVIPSLPYYASLGLAYSAELPAMDDLKAEAKSQLEEIIKKFKLPTDRVHVHVEEGSPKDRILELAKKIPAHMIIIASHRPDITTYLLGSNAAAVVRHAECSVLVVR	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12674
Length:	144 (141)
Sequences:	6937
Seq/Len:	49.20

USPF
Paralog alert: 0.77 [within 20: 0.26] - ratio of genomes with paralogs
Cluster includes: USPA USPC USPD USPF USPG

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
4_T	36_H	2.778	1.00
34_E	87_H	2.697	1.00
4_T	34_E	2.572	1.00
110_M	141_L	2.529	1.00
36_H	89_H	2.521	1.00
96_K	131_A	2.4	1.00
6_L	108_A	2.38	1.00
8_P	113_I	2.362	1.00
130_A	134_R	2.31	1.00
103_A	111_I	2.072	1.00
23_H	141_L	2.062	1.00
93_G	98_R	2.023	1.00
113_I	132_V	1.996	1.00
102_L	106_I	1.952	1.00
115_S	144_R	1.935	1.00
89_H	102_L	1.93	1.00
36_H	106_I	1.899	1.00
104_K	137_E	1.762	1.00
36_H	108_A	1.761	1.00
91_E	98_R	1.729	1.00
111_I	136_A	1.725	1.00
7_V	24_V	1.72	1.00
98_R	101_E	1.65	1.00
115_S	142_V	1.648	1.00
36_H	102_L	1.634	1.00
8_P	99_I	1.612	1.00
24_V	28_A	1.537	1.00
38_L	102_L	1.532	1.00
69_K	73_E	1.525	1.00
133_V	142_V	1.512	1.00
34_E	85_R	1.491	1.00
27_E	31_D	1.475	1.00
2_N	23_H	1.443	1.00
65_K	69_K	1.424	1.00
36_H	87_H	1.406	0.99
100_L	135_H	1.403	0.99
111_I	138_C	1.378	0.99
38_L	99_I	1.35	0.99
136_A	140_V	1.347	0.99
12_S	17_T	1.311	0.99
40_V	98_R	1.295	0.99
76_I	88_V	1.279	0.99
2_N	139_S	1.276	0.99
103_A	137_E	1.268	0.99
39_T	68_A	1.263	0.99
26_E	30_I	1.252	0.99
131_A	135_H	1.221	0.98
91_E	102_L	1.212	0.98
22_S	78_K	1.212	0.98
95_P	128_N	1.198	0.98
89_H	106_I	1.196	0.98
23_H	26_E	1.192	0.98
100_L	132_V	1.187	0.98
7_V	21_I	1.183	0.98
21_I	75_I	1.176	0.98
23_H	139_S	1.168	0.97
25_E	79_F	1.166	0.97
33_A	109_H	1.164	0.97
4_T	108_A	1.146	0.97
4_T	109_H	1.14	0.97
111_I	132_V	1.136	0.97
5_I	110_M	1.127	0.97
18_Q	78_K	1.124	0.97
24_V	35_V	1.12	0.96
100_L	103_A	1.103	0.96
129_A	142_V	1.086	0.96
17_T	20_V	1.08	0.95
11_I	75_I	1.063	0.95
101_E	105_K	1.058	0.95
99_I	132_V	1.043	0.94
7_V	35_V	1.029	0.94
103_A	108_A	1.021	0.93
75_I	78_K	1.018	0.93
81_L	84_D	1.017	0.93

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
3s3tA	8	0.9722	99.9	0.082	Contact Map	0.699
1mjhA	2	0.9861	99.9	0.096	Contact Map	0.877
3hgmA	4	0.9653	99.9	0.101	Contact Map	0.872
3fdxA	2	0.9792	99.9	0.103	Contact Map	0.747
2dumA	4	0.9722	99.9	0.11	Contact Map	0.8
3olqA	1	0.9722	99.9	0.112	Contact Map	0.757
3fg9A	6	0.9514	99.9	0.126	Contact Map	0.699
3loqA	2	0.9583	99.9	0.127	Contact Map	0.584
2gm3A	6	1	99.9	0.13	Contact Map	0.831
3tnjA	1	0.9514	99.9	0.136	Contact Map	0.779

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 3.7339 seconds.