OPENSEQ.org - USPA - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

USPA - Universal stress protein A

UniProt:	P0AED0	Sequence MAYKHILIAVDLSPESKVLVEKAVSMARPYNAKVSLIHVDVNYSDLYTGLIDVNLGDMQKRISEETHHALTELSTNAGYPITETLSGSGDLGQVLVDAIKKYDMDLVVCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDEEE	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG11390
Length:	144 (139)
Sequences:	6454
Seq/Len:	46.43

USPA
Paralog alert: 0.77 [within 20: 0.20] - ratio of genomes with paralogs
Cluster includes: USPA USPC USPD USPF USPG

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
33_K	83_E	2.651	1.00
5_H	35_S	2.628	1.00
5_H	33_K	2.561	1.00
124_R	128_N	2.431	1.00
92_G	125_Q	2.419	1.00
9_A	109_C	2.391	1.00
106_L	135_L	2.387	1.00
35_S	85_L	2.266	1.00
7_L	104_M	2.261	1.00
99_I	107_V	2.077	1.00
98_A	102_Y	2.046	1.00
109_C	126_L	2.043	1.00
89_G	94_V	1.922	1.00
111_H	138_P	1.912	1.00
85_L	98_A	1.849	1.00
22_K	135_L	1.846	1.00
35_S	102_Y	1.83	1.00
107_V	130_V	1.692	1.00
35_S	104_M	1.689	1.00
100_K	131_H	1.687	1.00
94_V	97_D	1.683	1.00
127_I	136_I	1.683	1.00
8_I	23_A	1.672	1.00
111_H	136_I	1.662	1.00
3_Y	22_K	1.648	1.00
87_G	94_V	1.647	1.00
67_H	71_T	1.624	1.00
21_E	76_N	1.563	1.00
35_S	98_A	1.543	1.00
74_S	84_T	1.502	1.00
38_H	66_T	1.496	1.00
9_A	95_L	1.467	1.00
23_A	27_A	1.451	1.00
39_V	94_V	1.4	0.99
33_K	81_I	1.361	0.99
107_V	132_V	1.342	0.99
35_S	83_E	1.316	0.99
26_M	30_Y	1.309	0.99
37_I	98_A	1.308	0.99
20_V	73_L	1.299	0.99
96_V	129_T	1.297	0.99
96_V	126_L	1.295	0.99
63_S	67_H	1.28	0.99
37_I	95_L	1.279	0.99
130_V	134_M	1.276	0.99
17_K	76_N	1.267	0.99
22_K	25_S	1.252	0.99
125_Q	129_T	1.249	0.99
22_K	133_D	1.233	0.98
74_S	78_G	1.221	0.98
25_S	29_P	1.21	0.98
8_I	20_V	1.207	0.98
3_Y	133_D	1.203	0.98
91_L	122_S	1.202	0.98
13_S	113_Q	1.202	0.98
123_A	136_I	1.193	0.98
96_V	99_I	1.18	0.98
13_S	16_S	1.176	0.98
6_I	106_L	1.168	0.97
87_G	98_A	1.168	0.97
24_V	77_A	1.166	0.97
85_L	102_Y	1.149	0.97
99_I	131_H	1.144	0.97
107_V	126_L	1.094	0.96
97_D	101_K	1.09	0.96
5_H	104_M	1.089	0.96
16_S	19_L	1.088	0.96
95_L	126_L	1.077	0.95
23_A	34_V	1.075	0.95
59_Q	63_S	1.058	0.95
99_I	104_M	1.033	0.94
26_M	108_V	1.03	0.94
69_A	73_L	1.02	0.93
5_H	105_D	1.004	0.93
27_A	32_A	1.004	0.93
10_V	73_L	1.002	0.92

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
3tnjA	1	0.9792	99.9	0.138	Contact Map	0.77
2dumA	4	1	99.9	0.149	Contact Map	0.792
1mjhA	2	0.9861	99.9	0.157	Contact Map	0.892
3s3tA	8	0.9514	99.9	0.16	Contact Map	0.724
1jmvA	4	0.9722	99.9	0.165	Contact Map	0.791
3olqA	1	1	99.9	0.166	Contact Map	0.772
3fg9A	6	0.9375	99.9	0.177	Contact Map	0.708
2gm3A	6	1	99.9	0.18	Contact Map	0.824
3hgmA	4	0.9375	99.9	0.191	Contact Map	0.891
1tq8A	6	0.9931	99.9	0.192	Contact Map	0.721

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 1.3827 seconds.