OPENSEQ.org - TABA - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

TABA - Toxin-antitoxin biofilm protein TabA

UniProt:	P0AF96	Sequence MIIGNIHNLQPWLPQELRQAIEHIKAHVTAETPKGKHDIEGNRLFYLISEDMTEPYEARRAEYHARYLDIQIVLKGQEGMTFSTQPAGAPDTDWLADKDIAFLPEGVDEKTVILNEGDFVVFYPGEVHKPLCAVGAPAQVRKAVVKMLMA	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12530
Length:	150 (147)
Sequences:	586
Seq/Len:	3.99

TABA
Paralog alert: 0.61 [within 20: 0.07] - ratio of genomes with paralogs
Cluster includes: TABA YHCH YIAL

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
40_E	43_R	2.755	1.00
4_G	8_N	2.327	1.00
45_F	67_Y	2.293	1.00
50_E	141_R	2.085	1.00
19_Q	40_E	1.997	1.00
52_M	139_Q	1.989	1.00
39_I	46_Y	1.876	1.00
49_S	144_V	1.847	1.00
71_Q	122_F	1.846	1.00
51_D	140_V	1.839	1.00
73_V	116_E	1.816	1.00
54_E	59_R	1.774	0.99
80_M	114_L	1.741	0.99
63_Y	126_E	1.738	0.99
5_N	118_D	1.724	0.99
129_K	132_C	1.654	0.99
34_K	50_E	1.643	0.99
37_H	48_I	1.641	0.99
63_Y	101_A	1.64	0.99
22_E	26_A	1.568	0.98
70_I	147_M	1.561	0.98
38_D	42_N	1.538	0.98
54_E	58_A	1.516	0.98
46_Y	143_A	1.513	0.98
88_G	127_V	1.512	0.98
20_A	145_V	1.462	0.97
102_F	130_P	1.453	0.97
28_V	31_E	1.445	0.97
59_R	131_L	1.441	0.97
17_L	21_I	1.43	0.96
53_T	137_P	1.414	0.96
70_I	121_V	1.405	0.96
68_L	123_Y	1.379	0.95
81_T	111_T	1.361	0.95
52_M	137_P	1.356	0.95
77_Q	138_A	1.355	0.95
55_P	58_A	1.349	0.95
33_P	37_H	1.347	0.95
14_P	17_L	1.32	0.94
79_G	113_I	1.302	0.93
9_L	143_A	1.284	0.93
41_G	67_Y	1.281	0.92
18_R	22_E	1.281	0.92
48_I	143_A	1.275	0.92
74_L	143_A	1.275	0.92
77_Q	115_N	1.273	0.92
9_L	21_I	1.26	0.92
65_A	85_Q	1.251	0.91
53_T	80_M	1.246	0.91
71_Q	80_M	1.208	0.89
36_K	70_I	1.202	0.89
60_R	102_F	1.174	0.87
51_D	131_L	1.168	0.87
133_A	137_P	1.165	0.87
61_A	127_V	1.156	0.86
113_I	134_V	1.143	0.85
4_G	119_F	1.142	0.85
103_L	126_E	1.133	0.85
36_K	42_N	1.106	0.83
61_A	109_E	1.104	0.83
114_L	120_V	1.098	0.82
60_R	92_T	1.087	0.81
40_E	45_F	1.084	0.81
71_Q	130_P	1.081	0.81
71_Q	144_V	1.075	0.80
66_R	96_A	1.074	0.80
17_L	147_M	1.061	0.79
34_K	37_H	1.046	0.78
84_T	121_V	1.04	0.77
16_E	21_I	1.038	0.77
98_K	141_R	1.023	0.75
24_I	74_L	1.021	0.75
95_L	98_K	1.014	0.75
2_I	123_Y	1.003	0.73

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1s4cA	4	0.9933	100	0.053	Contact Map	0.746
2gu9A	2	0.64	13.6	0.94	Contact Map	0.556
2j9iA	12	0.4467	13	0.941	Contact Map	0.135
1l2mA	1	0.2733	11.1	0.942	Contact Map	0.071
2oa2A	1	0.8	8.2	0.946	Contact Map	0.585
3gbgA	1	0.5867	7.9	0.946	Contact Map	0.652
2q30A	8	0.6933	7.2	0.947	Contact Map	0.533
1o4tA	2	0.7733	6.7	0.948	Contact Map	0.546
4i4aA	2	0.7267	6.5	0.948	Contact Map	0.681
3st7A	1	0.9133	6.3	0.949	Contact Map	0.164

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.3646 seconds.