OPENSEQ.org - YHCH - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YHCH - Uncharacterized protein YhcH

UniProt:	P45424	Sequence MMMGEVQSLPSAGLHPALQDALTLALAARPQEKAPGRYELQGDNIFMNVMTFNTQSPVEKKAELHEQYIDIQLLLNGEERILFGMAGTARQCEEFHHEDDYQLCSTIDNEQAIILKPGMFAVFMPGEPHKPGCVVGEPGEIKKVVVKVKADLMA	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12814
Length:	154 (153)
Sequences:	577
Seq/Len:	3.77

YHCH
Paralog alert: 0.62 [within 20: 0.07] - ratio of genomes with paralogs
Cluster includes: TABA YHCH YIAL

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
41_Q	44_N	2.643	1.00
44_N	149_K	2.591	1.00
46_F	68_Y	2.348	1.00
4_G	8_S	2.244	1.00
51_T	142_K	2.044	1.00
20_D	41_Q	1.988	1.00
53_N	140_E	1.952	1.00
50_M	145_V	1.897	1.00
40_L	47_M	1.874	1.00
74_L	117_P	1.867	1.00
72_Q	123_F	1.856	1.00
55_Q	60_K	1.84	1.00
81_I	115_L	1.768	0.99
52_F	141_I	1.766	0.99
5_E	119_M	1.76	0.99
35_P	51_T	1.715	0.99
23_T	27_A	1.712	0.99
4_G	12_A	1.679	0.99
64_L	127_E	1.669	0.99
39_E	43_D	1.62	0.99
64_L	102_Q	1.618	0.99
47_M	144_V	1.6	0.98
21_A	146_V	1.599	0.98
71_I	148_V	1.592	0.98
130_K	133_C	1.583	0.98
38_Y	49_V	1.536	0.98
29_R	32_E	1.485	0.97
54_T	138_P	1.481	0.97
55_Q	59_E	1.44	0.96
89_A	128_P	1.434	0.96
60_K	132_G	1.423	0.96
34_A	38_Y	1.418	0.96
71_I	122_V	1.392	0.95
82_L	112_A	1.364	0.94
103_L	131_P	1.355	0.94
69_I	124_M	1.351	0.94
18_L	22_L	1.351	0.94
42_G	68_Y	1.343	0.94
56_S	59_E	1.314	0.93
67_Q	149_K	1.31	0.93
78_E	116_K	1.307	0.93
114_I	135_V	1.283	0.92
78_E	139_G	1.28	0.92
80_R	114_I	1.279	0.92
19_Q	23_T	1.266	0.91
54_T	81_I	1.251	0.90
53_N	138_P	1.248	0.90
72_Q	81_I	1.246	0.90
9_L	144_V	1.244	0.90
9_L	22_L	1.226	0.89
35_P	38_Y	1.201	0.88
4_G	120_F	1.201	0.88
61_K	103_L	1.188	0.87
104_C	127_E	1.18	0.87
52_F	132_G	1.176	0.86
15_H	18_L	1.149	0.85
49_V	144_V	1.148	0.85
75_L	144_V	1.141	0.84
2_M	124_M	1.137	0.84
72_Q	145_V	1.115	0.82
37_R	43_D	1.112	0.82
134_V	138_P	1.1	0.81
18_L	148_V	1.085	0.80
41_Q	46_F	1.083	0.80
72_Q	131_P	1.068	0.78
37_R	71_I	1.051	0.77
13_G	19_Q	1.043	0.76
38_Y	54_T	1.04	0.76
62_A	110_E	1.028	0.74
96_H	99_D	1.022	0.74
17_A	22_L	1.015	0.73
62_A	128_P	1.015	0.73
115_L	121_A	1.012	0.73
25_A	73_L	1.005	0.72
25_A	75_L	1.003	0.72

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1s4cA	4	0.987	100	0.014	Contact Map	0.735
2gu9A	2	0.6429	20.1	0.936	Contact Map	0.558
3gbgA	1	0.5909	17.9	0.938	Contact Map	0.65
2oa2A	1	0.8312	14.9	0.94	Contact Map	0.577
1o4tA	2	0.7792	12.5	0.942	Contact Map	0.518
4i4aA	2	0.7338	11.7	0.943	Contact Map	0.663
1v70A	1	0.6818	8.5	0.946	Contact Map	0.63
2j9iA	12	0.4351	8.1	0.947	Contact Map	0.13
2fqpA	4	0.6169	8.1	0.947	Contact Map	0.351
4c92G	1	0.4481	7.8	0.947	Contact Map	0

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 1.3859 seconds.