OPENSEQ.org - SGCB - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

SGCB - Putative phosphotransferase enzyme IIB component SgcB

UniProt:	P58035	Sequence MKKILVACGTGMSTSTMIAHKLQEFLTEQGISATTAQCCLNEIPLNCNGMDLIVTSMRTNSDYGIPTLNGAALLTGINDDALKQQIKALLTQ	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG14343
Length:	92 (92)
Sequences:	302
Seq/Len:	3.28

SGCB
Paralog alert: 0.55 [within 20: 0.07] - ratio of genomes with paralogs
Cluster includes: PTKB SGCB ULAB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
84_Q	88_A	3.095	1.00
29_Q	87_K	2.499	1.00
18_I	56_S	2.184	1.00
22_L	54_V	2.104	1.00
38_C	42_E	1.779	0.99
29_Q	84_Q	1.657	0.98
72_A	82_L	1.655	0.98
22_L	27_T	1.568	0.97
89_L	92_Q	1.553	0.97
81_A	84_Q	1.551	0.97
25_F	73_L	1.511	0.97
39_C	42_E	1.504	0.96
23_Q	27_T	1.481	0.96
4_I	26_L	1.467	0.96
52_L	90_L	1.461	0.96
87_K	91_T	1.452	0.95
80_D	84_Q	1.436	0.95
16_T	37_Q	1.41	0.94
68_L	89_L	1.387	0.94
35_T	77_I	1.353	0.93
20_H	23_Q	1.35	0.92
25_F	29_Q	1.333	0.92
38_C	43_I	1.281	0.90
10_T	23_Q	1.236	0.87
37_Q	42_E	1.21	0.86
85_Q	89_L	1.193	0.85
73_L	83_K	1.158	0.82
47_C	65_I	1.15	0.82
85_Q	88_A	1.137	0.81
19_A	35_T	1.131	0.80
40_L	57_M	1.119	0.79
38_C	73_L	1.117	0.79
18_I	57_M	1.113	0.79
6_V	37_Q	1.112	0.78
88_A	91_T	1.112	0.78
12_M	78_N	1.106	0.78
28_E	83_K	1.08	0.76
62_D	66_P	1.072	0.75
41_N	56_S	1.061	0.74
78_N	81_A	1.045	0.72

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1tvmA	1	1	99.8	0.381	Contact Map	0.332
3nbmA	1	0.9674	99.7	0.414	Contact Map	0.374
4mgeA	2	0.9674	99.6	0.437	Contact Map	0.496
1e2bA	1	0.9783	99.6	0.44	Contact Map	0.343
2l2qA	1	0.9783	99.6	0.451	Contact Map	0.315
1vkrA	1	0.9674	99.6	0.468	Contact Map	0.424
3czcA	1	0.9565	99.5	0.49	Contact Map	0.529
2kyrA	1	0.9891	99.3	0.538	Contact Map	0.544
2m1zA	1	0.9891	99.3	0.551	Contact Map	0.329
3sqnA	2	0.9348	98.9	0.611	Contact Map	0.347

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0153 seconds.