OPENSEQ.org - PTKB - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

PTKB - Galactitol-specific phosphotransferase enzyme IIB component

UniProt:	P37188	Sequence MKRKIIVACGGAVATSTMAAEEIKELCQNHNIPVELIQCRVNEIETYMDGVHLICTTAKVDRSFGDIPLVHGMPFISGIGIEALQNKILTILQG	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12415
Length:	94 (92)
Sequences:	304
Seq/Len:	3.30

PTKB
Paralog alert: 0.55 [within 20: 0.07] - ratio of genomes with paralogs
Cluster includes: PTKB SGCB ULAB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
86_N	90_T	3.101	1.00
30_H	89_L	2.497	1.00
19_A	57_T	2.172	1.00
23_I	55_C	2.098	1.00
39_C	43_E	1.754	0.99
74_P	84_L	1.622	0.98
30_H	86_N	1.599	0.98
83_A	86_N	1.554	0.97
26_L	75_F	1.521	0.97
23_I	28_Q	1.513	0.97
40_R	43_E	1.501	0.96
53_L	92_L	1.5	0.96
91_I	94_G	1.499	0.96
89_L	93_Q	1.476	0.96
24_K	28_Q	1.469	0.96
70_V	91_I	1.443	0.95
36_L	79_I	1.434	0.95
5_I	27_C	1.422	0.95
17_T	38_Q	1.397	0.94
21_E	24_K	1.366	0.93
26_L	30_H	1.346	0.92
82_E	86_N	1.284	0.90
39_C	44_I	1.265	0.89
11_G	24_K	1.244	0.88
87_K	91_I	1.238	0.88
23_I	88_I	1.223	0.87
38_Q	43_E	1.211	0.86
90_T	93_Q	1.201	0.85
48_M	67_I	1.169	0.83
29_N	85_Q	1.159	0.82
20_A	36_L	1.15	0.82
75_F	85_Q	1.149	0.82
39_C	75_F	1.13	0.80
7_V	38_Q	1.113	0.79
41_V	58_A	1.108	0.78
19_A	58_A	1.106	0.78
13_V	80_G	1.078	0.76
87_K	90_T	1.065	0.74
63_S	68_P	1.06	0.74
42_N	57_T	1.042	0.72
80_G	83_A	1.032	0.71
27_C	76_I	1.026	0.70
59_K	75_F	1.021	0.70
25_E	53_L	1.005	0.68
7_V	23_I	1.004	0.68

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1tvmA	1	1	99.7	0.402	Contact Map	0.305
3nbmA	1	0.9574	99.7	0.428	Contact Map	0.366
1e2bA	1	0.9681	99.7	0.435	Contact Map	0.364
4mgeA	2	0.9468	99.6	0.446	Contact Map	0.489
2l2qA	1	0.9574	99.6	0.457	Contact Map	0.297
1vkrA	1	0.9574	99.5	0.486	Contact Map	0.404
3czcA	1	0.9468	99.5	0.509	Contact Map	0.521
2kyrA	1	0.9894	99.4	0.522	Contact Map	0.512
2m1zA	1	0.9894	99.4	0.535	Contact Map	0.31
3sqnA	2	0.9255	98.9	0.625	Contact Map	0.323

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.1383 seconds.