OPENSEQ.org - TUSD - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

TUSD - Sulfurtransferase TusD

UniProt:	P45532	Sequence MRFAIVVTGPAYGTQQASSAFQFAQALIADGHELSSVFFYREGVYNANQLTSPASDEFDLVRAWQQLNAQHGVALNICVAAALRRGVVDETEAGRLGLASSNLQQGFTLSGLGALAEASLTCDRVVQF	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12898
Length:	128 (128)
Sequences:	410
Seq/Len:	3.20

TUSD
Paralog alert: 0.63 [within 20: 0.00] - ratio of genomes with paralogs
Cluster includes: TUSD YCHN

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
4_A	122_C	3.02	1.00
47_A	77_I	2.683	1.00
27_L	34_L	2.305	1.00
58_F	63_A	2.168	1.00
5_I	24_A	2.1	1.00
51_T	61_V	2.051	1.00
37_V	75_L	1.864	0.99
68_N	75_L	1.818	0.99
90_E	94_G	1.812	0.99
59_D	62_R	1.806	0.99
92_E	95_R	1.78	0.99
12_Y	53_P	1.709	0.99
36_S	118_A	1.63	0.98
2_R	33_E	1.603	0.98
66_Q	70_Q	1.581	0.97
87_V	103_L	1.477	0.96
65_Q	106_G	1.442	0.95
75_L	107_F	1.395	0.94
25_Q	29_A	1.388	0.93
36_S	74_A	1.323	0.91
43_G	46_N	1.293	0.90
13_G	54_A	1.289	0.90
7_V	20_A	1.286	0.89
65_Q	104_Q	1.264	0.88
17_A	46_N	1.249	0.88
80_A	113_G	1.24	0.87
3_F	27_L	1.233	0.87
9_G	16_Q	1.232	0.87
31_G	43_G	1.204	0.85
92_E	97_G	1.197	0.84
92_E	96_L	1.172	0.83
40_Y	80_A	1.163	0.82
94_G	101_S	1.137	0.80
80_A	109_L	1.13	0.79
33_E	91_T	1.128	0.79
28_I	31_G	1.126	0.79
32_H	43_G	1.122	0.79
28_I	73_V	1.121	0.79
21_F	58_F	1.11	0.78
39_F	75_L	1.108	0.77
27_L	120_L	1.095	0.76
1_M	68_N	1.091	0.76
114_A	117_E	1.091	0.76
1_M	124_R	1.081	0.75
64_W	107_F	1.079	0.75
12_Y	42_E	1.07	0.74
91_T	96_L	1.069	0.74
4_A	77_I	1.06	0.73
91_T	94_G	1.059	0.73
33_E	69_A	1.055	0.72
8_T	127_Q	1.033	0.70
39_F	64_W	1.028	0.70
48_N	102_N	1.023	0.69
69_A	105_Q	1.022	0.69
13_G	27_L	1.018	0.69
94_G	97_G	1.017	0.68
66_Q	87_V	1.008	0.67
116_A	119_S	1.007	0.67
29_A	88_V	1	0.67
24_A	27_L	1	0.67

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2d1pA	3	1	100	0.245	Contact Map	0.633
2hy5A	1	1	100	0.284	Contact Map	0.649
2hy5B	1	0.9844	100	0.353	Contact Map	0.42
2d1pB	3	0.9062	99.9	0.457	Contact Map	0.576
1jx7A	6	0.8906	99.9	0.493	Contact Map	0.703
2hy5C	1	0.7891	99.9	0.551	Contact Map	0.594
3mc3A	1	0.8984	99.8	0.552	Contact Map	0.629
2qs7A	4	0.875	99.7	0.633	Contact Map	0.587
3pnxA	6	0.8828	99.6	0.655	Contact Map	0.616
2fb6A	1	0.8281	99.4	0.693	Contact Map	0.502

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0135 seconds.