OPENSEQ.org - YCHN - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YCHN - Protein YchN

UniProt:	P0AB52	Sequence MQKIVIVANGAPYGSESLFNSLRLAIALREQESNLDLRLFLMSDAVTAGLRGQKPGEGYNIQQMLEILTAQNVPVKLCKTCTDGRGISTLPLIDGVEIGTLVELAQWTLSADKVLTF	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12404
Length:	117 (115)
Sequences:	452
Seq/Len:	3.93

YCHN
Paralog alert: 0.62 [within 20: 0.00] - ratio of genomes with paralogs
Cluster includes: TUSD YCHN

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
5_V	111_A	3.199	1.00
49_G	77_L	2.707	1.00
28_L	37_L	2.21	1.00
39_L	75_V	2.071	1.00
60_N	63_Q	2.021	1.00
69_T	75_V	1.904	1.00
6_I	25_A	1.904	1.00
53_Q	62_Q	1.891	1.00
13_Y	55_P	1.825	1.00
38_R	107_W	1.809	1.00
67_I	71_Q	1.678	0.99
38_R	74_P	1.667	0.99
3_K	34_N	1.64	0.99
87_I	92_L	1.578	0.98
26_I	30_E	1.518	0.98
14_G	56_G	1.359	0.95
13_Y	44_D	1.355	0.95
66_E	93_I	1.325	0.94
103_E	106_Q	1.274	0.92
42_M	80_T	1.267	0.92
66_E	95_G	1.251	0.91
80_T	102_V	1.244	0.91
4_I	28_L	1.228	0.90
29_R	32_E	1.214	0.89
5_V	77_L	1.206	0.89
10_G	17_S	1.201	0.89
45_A	48_A	1.198	0.88
7_V	114_V	1.189	0.88
80_T	98_I	1.163	0.86
103_E	108_T	1.138	0.85
52_G	91_P	1.133	0.84
8_A	21_S	1.124	0.84
83_D	92_L	1.123	0.84
29_R	73_V	1.118	0.83
64_M	90_L	1.115	0.83
18_L	48_A	1.114	0.83
9_N	116_T	1.111	0.83
2_Q	113_K	1.105	0.82
28_L	109_L	1.096	0.82
50_L	91_P	1.09	0.81
41_L	45_A	1.083	0.81
5_V	103_E	1.08	0.80
63_Q	93_I	1.08	0.80
75_V	96_V	1.075	0.80
19_F	111_A	1.061	0.79
77_L	99_G	1.059	0.78
30_E	66_E	1.058	0.78
61_I	64_M	1.049	0.78
7_V	116_T	1.04	0.77
47_T	91_P	1.034	0.76
16_E	20_N	1.023	0.75
49_G	96_V	1.018	0.74
23_R	26_I	1.017	0.74
39_L	105_A	1.012	0.74

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2d1pA	3	0.9829	100	0.219	Contact Map	0.655
2hy5A	1	0.9744	100	0.244	Contact Map	0.707
2hy5B	1	0.9829	100	0.283	Contact Map	0.495
2d1pB	3	0.9829	99.9	0.323	Contact Map	0.573
1jx7A	6	0.9829	99.9	0.34	Contact Map	0.674
3mc3A	1	0.8803	99.9	0.416	Contact Map	0.572
2hy5C	1	0.8547	99.8	0.455	Contact Map	0.513
2qs7A	4	0.9573	99.8	0.507	Contact Map	0.549
3pnxA	6	0.9573	99.8	0.517	Contact Map	0.569
2fb6A	1	0.9316	99.6	0.563	Contact Map	0.489

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0135 seconds.