OPENSEQ.org - IDNK - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

IDNK - Thermosensitive gluconokinase

UniProt:	P39208	Sequence MAGESFILMGVSGSGKTLIGSKVAALLSAKFIDGDDLHPAKNIDKMSQGIPLSDEDRLPWLERLNDASYSLYKKNETGFIVCSSLKKQYRDILRKGSPHVHFLWLDGDYETILARMQRRAGHFMPVALLKSQFEALERPQADEQDIVRIDINHDIANVTEQCRQAVLAIRQNRICAKEGSASDQRCE	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12152
Length:	187 (166)
Sequences:	805
Seq/Len:	4.85

IDNK
Paralog alert: 0.27 [within 20: 0.00] - ratio of genomes with paralogs
Cluster includes: GNTK IDNK

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
109_Y	130_K	3.952	1.00
125_P	128_L	3.684	1.00
112_I	133_F	3.676	1.00
149_I	158_V	3.641	1.00
40_A	44_D	3.452	1.00
106_D	138_R	2.919	1.00
107_G	151_I	2.919	1.00
37_L	64_L	2.879	1.00
130_K	134_E	2.849	1.00
33_D	81_V	2.791	1.00
139_P	146_I	2.754	1.00
62_E	92_I	2.714	1.00
45_K	56_D	2.599	1.00
116_M	129_L	2.432	1.00
39_P	42_N	2.326	1.00
107_G	112_I	2.097	1.00
26_L	160_E	1.99	1.00
12_S	129_L	1.95	1.00
29_A	77_T	1.874	1.00
32_I	37_L	1.838	1.00
104_W	138_R	1.826	1.00
91_D	94_R	1.803	1.00
64_L	80_I	1.687	0.99
32_I	67_A	1.666	0.99
31_F	81_V	1.66	0.99
143_E	146_I	1.648	0.99
18_L	155_I	1.642	0.99
22_K	155_I	1.638	0.99
7_I	102_F	1.574	0.99
34_G	80_I	1.568	0.99
17_T	21_S	1.561	0.99
94_R	102_F	1.554	0.99
154_D	157_N	1.507	0.98
114_A	118_R	1.503	0.98
61_L	89_Y	1.493	0.98
104_W	139_P	1.466	0.98
39_P	63_R	1.428	0.98
20_G	31_F	1.365	0.97
68_S	80_I	1.343	0.96
39_P	43_I	1.341	0.96
19_I	158_V	1.337	0.96
153_H	157_N	1.301	0.95
108_D	152_N	1.292	0.95
108_D	111_T	1.288	0.95
58_L	62_E	1.258	0.94
161_Q	165_A	1.246	0.94
139_P	143_E	1.208	0.92
59_P	129_L	1.186	0.91
106_D	148_R	1.169	0.90
67_A	78_G	1.155	0.90
111_T	152_N	1.14	0.89
66_D	70_S	1.139	0.89
109_Y	113_L	1.123	0.88
20_G	33_D	1.112	0.87
10_G	16_K	1.096	0.86
24_A	79_F	1.09	0.86
6_F	103_L	1.078	0.85
61_L	82_C	1.075	0.85
65_N	96_G	1.073	0.85
155_I	159_T	1.072	0.84
112_I	151_I	1.063	0.84
55_E	58_L	1.058	0.83
10_G	15_G	1.044	0.82
107_G	111_T	1.042	0.82
103_L	162_C	1.038	0.82
56_D	89_Y	1.038	0.82
116_M	124_M	1.037	0.82
47_S	123_F	1.037	0.82
109_Y	133_F	1.014	0.80
44_D	47_S	1.007	0.79
26_L	159_T	1.006	0.79

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
4eunA	1	0.9305	100	0.65	Contact Map	0.64
1knqA	2	0.9091	100	0.66	Contact Map	0.723
3t61A	2	0.9733	99.9	0.676	Contact Map	0.721
2rhmA	4	0.9144	99.9	0.713	Contact Map	0.401
2gksA	2	0.877	99.9	0.724	Contact Map	0.648
1m8pA	3	0.8824	99.9	0.728	Contact Map	0.714
1m7gA	4	0.8877	99.9	0.728	Contact Map	0.654
2yvuA	2	0.8556	99.8	0.732	Contact Map	0.667
1e6cA	2	0.8503	99.8	0.734	Contact Map	0.537
1qhxA	1	0.8556	99.8	0.738	Contact Map	0.568

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0167 seconds.