OPENSEQ.org - INSA7 - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

INSA7 - Insertion element IS1 7 protein InsA

UniProt:	P19767	Sequence MASISIRCPSCSATEGVVRNGKSTAGHQRYLCSPCRKTWQLQFTYTASQPGKHQKIIDMAMNGVGCRASARIMGVGLNTVLRHLKNSGRSR	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:
Length:	91 (91)
Sequences:	183
Seq/Len:	2.01

INSA7
Paralog alert: 0.43 [within 20: 0.08] - ratio of genomes with paralogs
Cluster includes: INSA1 INSA2 INSA3 INSA4 INSA5 INSA6 INSA7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
27_H	40_Q	2.153	0.99
78_N	82_R	2.051	0.99
21_G	35_C	1.761	0.97
59_M	62_N	1.651	0.95
84_L	87_S	1.582	0.94
52_K	55_K	1.575	0.94
2_A	6_I	1.552	0.93
63_G	79_T	1.542	0.93
57_I	60_A	1.52	0.92
74_G	78_N	1.476	0.90
8_C	35_C	1.464	0.90
29_R	38_T	1.385	0.86
14_T	26_G	1.378	0.86
35_C	71_R	1.338	0.83
64_V	72_I	1.335	0.83
62_N	71_R	1.324	0.82
77_L	83_H	1.305	0.81
43_F	53_H	1.292	0.80
59_M	72_I	1.281	0.79
65_G	68_A	1.255	0.78
21_G	32_C	1.253	0.77
58_D	72_I	1.244	0.77
43_F	48_S	1.223	0.75
62_N	68_A	1.218	0.75
32_C	35_C	1.208	0.74
68_A	84_L	1.201	0.73
26_G	32_C	1.176	0.71
21_G	28_Q	1.173	0.71
63_G	67_R	1.166	0.70
68_A	77_L	1.157	0.69
19_R	28_Q	1.155	0.69
16_G	39_W	1.144	0.68
3_S	90_S	1.132	0.67
8_C	21_G	1.125	0.66
21_G	30_Y	1.117	0.65
22_K	26_G	1.106	0.64
13_A	34_P	1.102	0.64
74_G	79_T	1.096	0.63
86_N	89_R	1.089	0.62
8_C	11_C	1.072	0.60
28_Q	32_C	1.072	0.60
3_S	6_I	1.039	0.57
60_A	83_H	1.034	0.56
80_V	83_H	1.032	0.56
79_T	83_H	1.026	0.55
81_L	85_K	1.025	0.55
1_M	4_I	1.025	0.55
40_Q	51_G	1.015	0.54
7_R	10_S	1.009	0.53
59_M	76_G	1.002	0.53

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2jn6A	1	0.5385	97.7	0.75	Contact Map	0.376
1u78A	1	0.5495	97.6	0.754	Contact Map	0.413
2rn7A	1	0.5495	97.3	0.767	Contact Map	0.335
1pdnC	1	0.6703	97.3	0.768	Contact Map	0.331
2k27A	1	0.7582	97.3	0.768	Contact Map	0.358
1tc3C	1	0.5385	97.3	0.769	Contact Map	0.342
2elhA	1	0.6813	97.3	0.769	Contact Map	0.315
3o9xA	2	0.956	97.2	0.771	Contact Map	0.392
1jkoC	1	0.5385	97.2	0.772	Contact Map	0.242
4dyqA	2	0.6154	97.2	0.773	Contact Map	0.357

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0097 seconds.