OPENSEQ.org - INSA1 - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

INSA1 - Insertion element IS1 1 protein InsA

UniProt:	P0CF07	Sequence MASVSISCPSCSATDGVVRNGKSTAGHQRYLCSHCRKTWQLQFTYTASQPGTHQKIIDMAMNGVGCRATARIMGVGLNTILRHLKNSGRSR	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG40001
Length:	91 (91)
Sequences:	178
Seq/Len:	1.96

INSA1
Paralog alert: 0.43 [within 20: 0.08] - ratio of genomes with paralogs
Cluster includes: INSA1 INSA2 INSA3 INSA4 INSA5 INSA6 INSA7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
27_H	40_Q	2.187	1.00
78_N	82_R	1.93	0.99
21_G	35_C	1.789	0.97
59_M	62_N	1.658	0.95
52_T	55_K	1.589	0.94
84_L	87_S	1.589	0.94
57_I	60_A	1.552	0.93
8_C	35_C	1.488	0.90
74_G	78_N	1.483	0.90
2_A	6_I	1.469	0.90
14_T	26_G	1.4	0.86
29_R	38_T	1.394	0.86
63_G	79_T	1.393	0.86
59_M	72_I	1.351	0.84
35_C	71_R	1.326	0.82
62_N	71_R	1.314	0.81
43_F	53_H	1.31	0.81
64_V	72_I	1.305	0.81
58_D	72_I	1.288	0.79
77_L	83_H	1.284	0.79
65_G	68_A	1.271	0.78
21_G	32_C	1.27	0.78
68_A	84_L	1.242	0.76
43_F	48_S	1.231	0.75
62_N	68_A	1.225	0.74
32_C	35_C	1.224	0.74
63_G	67_R	1.214	0.73
21_G	30_Y	1.212	0.73
26_G	32_C	1.198	0.72
19_R	28_Q	1.191	0.71
16_G	39_W	1.162	0.69
21_G	28_Q	1.157	0.68
74_G	79_T	1.146	0.67
8_C	21_G	1.142	0.67
22_K	26_G	1.138	0.66
68_A	77_L	1.135	0.66
13_A	34_H	1.127	0.65
3_S	90_S	1.095	0.62
1_M	4_V	1.067	0.59
8_C	11_C	1.054	0.58
28_Q	32_C	1.049	0.57
60_A	83_H	1.045	0.57
81_L	85_K	1.035	0.56
59_M	76_G	1.034	0.55
57_I	77_L	1.024	0.54
7_S	10_S	1.02	0.54
6_I	44_T	1.019	0.54
40_Q	51_G	1.018	0.54
20_N	38_T	1.012	0.53
15_D	91_R	1.009	0.53

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2jn6A	1	0.5385	97.7	0.749	Contact Map	0.305
1u78A	1	0.5495	97.6	0.752	Contact Map	0.386
1pdnC	1	0.6703	97.3	0.766	Contact Map	0.289
2rn7A	1	0.5495	97.3	0.766	Contact Map	0.268
2k27A	1	0.7582	97.3	0.767	Contact Map	0.297
1tc3C	1	0.5385	97.3	0.767	Contact Map	0.323
2elhA	1	0.6813	97.3	0.768	Contact Map	0.244
3o9xA	2	0.956	97.2	0.769	Contact Map	0.346
4dyqA	2	0.6154	97.2	0.77	Contact Map	0.303
1jkoC	1	0.5385	97.2	0.771	Contact Map	0.202

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0323 seconds.