OPENSEQ.org - YBAZ - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YBAZ - Uncharacterized protein YbaZ

UniProt:	P0AFP2	Sequence MLVSCAMRLHSGVFPDYAEKLPQEEKMEKEDSFPQRVWQIVAAIPEGYVTTYGDVAKLAGSPRAARQVGGVLKRLPEGSTLPWHRVVNRHGTISLTGPDLQRQRQALLAEGVMVSGSGQIDLQRYRWNY	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13254
Length:	129 (110)
Sequences:	451
Seq/Len:	4.10

YBAZ
Paralog alert: 0.01 [within 20: 0.00] - ratio of genomes with paralogs
Cluster includes: OGT YBAZ

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
50_T	54_D	3.228	1.00
41_V	55_V	2.402	1.00
54_D	126_R	2.139	1.00
104_R	108_L	2.115	1.00
33_F	37_V	1.923	1.00
75_L	83_W	1.887	1.00
38_W	71_V	1.844	1.00
88_N	94_S	1.837	1.00
41_V	44_I	1.808	1.00
61_S	64_A	1.739	0.99
114_V	129_Y	1.705	0.99
34_P	71_V	1.65	0.99
39_Q	43_A	1.646	0.99
75_L	79_S	1.589	0.99
83_W	93_I	1.574	0.98
33_F	61_S	1.572	0.98
44_I	50_T	1.546	0.98
40_I	55_V	1.471	0.97
50_T	55_V	1.465	0.97
34_P	70_G	1.399	0.96
94_S	103_Q	1.391	0.96
51_T	122_L	1.371	0.95
97_G	100_L	1.356	0.95
21_L	26_K	1.311	0.94
83_W	94_S	1.308	0.94
116_G	119_Q	1.292	0.93
57_K	62_P	1.238	0.91
44_I	68_V	1.237	0.91
18_A	21_L	1.22	0.90
44_I	86_V	1.216	0.90
23_Q	26_K	1.212	0.90
75_L	78_G	1.21	0.90
83_W	95_L	1.2	0.89
113_M	125_Y	1.167	0.87
51_T	126_R	1.136	0.85
97_G	102_R	1.129	0.85
51_T	114_V	1.122	0.85
58_L	103_Q	1.119	0.84
40_I	58_L	1.118	0.84
102_R	106_A	1.11	0.84
115_S	125_Y	1.106	0.83
41_V	72_L	1.102	0.83
121_D	124_R	1.092	0.82
72_L	93_I	1.073	0.81
83_W	103_Q	1.065	0.80
116_G	124_R	1.06	0.80
116_G	123_Q	1.058	0.79
64_A	67_Q	1.057	0.79
57_K	64_A	1.057	0.79
119_Q	122_L	1.035	0.77
113_M	116_G	1.025	0.76
18_A	23_Q	1.023	0.76
122_L	125_Y	1.017	0.76
67_Q	71_V	1.016	0.75
60_G	66_R	1.015	0.75
54_D	58_L	1.015	0.75
18_A	22_P	1.009	0.75
69_G	75_L	1.007	0.75

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1eh6A	1	1	100	0.251	Contact Map	0.401
2kifA	1	0.7752	100	0.252	Contact Map	0.597
3gvaA	2	0.7907	100	0.267	Contact Map	0.599
4bhbA	1	0.9457	100	0.305	Contact Map	0.5
1sfeA	1	0.8992	100	0.309	Contact Map	0.545
3l00A	1	0.907	100	0.31	Contact Map	0.421
1wrjA	1	0.907	100	0.326	Contact Map	0.494
2g7hA	1	0.8992	100	0.352	Contact Map	0.27
1mgtA	1	0.8682	100	0.37	Contact Map	0.422
1qgpA	1	0.5426	34.4	0.927	Contact Map	0.619

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0252 seconds.