OPENSEQ.org - OGT - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

OGT - Methylated-DNA--protein-cysteine methyltransferase

UniProt:	P0AFH0	Sequence MLRLLEEKIATPLGPLWVICDEQFRLRAVEWEEYSERMVQLLDIHYRKEGYERISATNPGGLSDKLREYFAGNLSIIDTLPTATGGTPFQREVWKTLRTIPCGQVMHYGQLAEQLGRPGAARAVGAANGSNPISIVVPCHRVIGRNGTMTGYAGGVQRKEWLLRHEGYLLL	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG10668
Length:	171 (166)
Sequences:	2753
Seq/Len:	16.58

OGT
Paralog alert: 0.40 [within 20: 0.01] - ratio of genomes with paralogs
Cluster includes: OGT YBAZ

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
68_E	74_L	3.944	1.00
144_G	150_T	3.93	1.00
161_W	165_H	3.754	1.00
92_E	117_R	3.087	1.00
96_T	99_T	2.797	1.00
106_M	114_Q	2.572	1.00
109_G	145_R	2.468	1.00
86_G	94_W	2.453	1.00
106_M	111_L	2.407	1.00
21_D	83_A	2.33	1.00
84_T	137_V	2.255	1.00
18_V	26_L	2.223	1.00
106_M	110_Q	2.167	1.00
87_T	90_Q	2.148	1.00
109_G	113_E	2.129	1.00
110_Q	113_E	2.066	1.00
10_A	15_P	2.025	1.00
100_I	142_V	2.023	1.00
65_K	77_I	1.973	1.00
21_D	24_F	1.954	1.00
160_E	164_R	1.919	1.00
96_T	111_L	1.777	1.00
12_P	70_F	1.776	1.00
68_E	73_N	1.773	1.00
149_M	156_V	1.761	1.00
96_T	114_Q	1.697	1.00
121_A	125_G	1.692	1.00
100_I	106_M	1.666	1.00
65_K	80_L	1.66	1.00
93_V	111_L	1.649	1.00
129_G	150_T	1.648	1.00
90_Q	130_S	1.622	1.00
11_T	14_G	1.584	1.00
99_T	114_Q	1.557	1.00
29_V	136_V	1.527	1.00
97_L	128_N	1.475	1.00
9_I	67_R	1.448	1.00
56_A	64_D	1.425	1.00
86_G	90_Q	1.421	1.00
96_T	115_L	1.41	1.00
13_L	16_L	1.39	0.99
24_F	83_A	1.368	0.99
95_K	98_R	1.367	0.99
106_M	142_V	1.362	0.99
134_S	154_G	1.342	0.99
65_K	74_L	1.336	0.99
128_N	143_I	1.333	0.99
117_R	120_A	1.332	0.99
151_G	156_V	1.296	0.99
126_A	129_G	1.272	0.99
164_R	167_G	1.263	0.99
65_K	78_D	1.245	0.98
11_T	16_L	1.235	0.98
109_G	121_A	1.225	0.98
88_P	91_R	1.214	0.98
90_Q	94_W	1.202	0.98
21_D	27_R	1.173	0.98
64_D	68_E	1.166	0.97
94_W	97_L	1.158	0.97
8_K	15_P	1.156	0.97
33_E	158_R	1.142	0.97
66_L	70_F	1.132	0.97
89_F	123_A	1.114	0.96
100_I	111_L	1.102	0.96
23_Q	83_A	1.1	0.96
31_W	158_R	1.087	0.96
125_G	129_G	1.081	0.95
65_K	75_S	1.075	0.95
74_L	77_I	1.064	0.95
128_N	134_S	1.062	0.95
26_L	57_T	1.054	0.95
91_R	95_K	1.041	0.94
115_L	120_A	1.04	0.94
126_A	150_T	1.038	0.94
144_G	151_G	1.029	0.94
69_Y	102_C	1.021	0.93
109_G	125_G	1.021	0.93
16_L	29_V	1.002	0.92
19_I	27_R	1	0.92

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1sfeA	1	0.9766	100	0.116	Contact Map	0.623
4bhbA	1	0.924	100	0.145	Contact Map	0.693
3l00A	1	0.9708	100	0.162	Contact Map	0.536
1eh6A	1	0.9708	100	0.164	Contact Map	0.501
1wrjA	1	0.8772	100	0.179	Contact Map	0.674
2g7hA	1	0.8538	100	0.288	Contact Map	0.356
1mgtA	1	0.9357	100	0.291	Contact Map	0.549
2kifA	1	0.5029	100	0.393	Contact Map	0.609
3gvaA	2	0.5146	100	0.396	Contact Map	0.651
3ugoA	1	0.7251	20.2	0.945	Contact Map	0.135

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.038 seconds.