OPENSEQ.org - MAZE - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

MAZE - Antitoxin MazE

UniProt:	P0AE72	Sequence MIHSSVKRWGNSPAVRIPATLMQALNLNIDDEVKIDLVDGKLIIEPVRKEPVFTLAELVNDITPENLHENIDWGEPKDKEVW	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG10571
Length:	82 (82)
Sequences:	293
Seq/Len:	3.57

MAZE
Paralog alert: 0.28 [within 20: 0.01] - ratio of genomes with paralogs
Cluster includes: CHPS MAZE

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
13_P	22_M	3.776	1.00
9_W	16_R	2.821	1.00
63_T	66_N	2.522	1.00
41_K	45_E	2.256	1.00
55_L	59_V	2.06	1.00
33_V	44_I	2.05	1.00
17_I	22_M	1.849	0.99
13_P	29_I	1.772	0.99
62_I	66_N	1.708	0.99
19_A	23_Q	1.686	0.99
9_W	14_A	1.617	0.98
38_V	41_K	1.604	0.98
9_W	12_S	1.565	0.98
15_V	33_V	1.544	0.98
7_K	30_D	1.538	0.97
11_N	16_R	1.471	0.96
53_F	58_L	1.371	0.94
25_L	42_L	1.345	0.93
11_N	14_A	1.301	0.92
7_K	16_R	1.288	0.91
15_V	42_L	1.288	0.91
59_V	62_I	1.276	0.91
22_M	29_I	1.227	0.88
12_S	16_R	1.226	0.88
48_R	52_V	1.195	0.86
7_K	31_D	1.192	0.86
35_I	60_N	1.183	0.86
58_L	61_D	1.178	0.85
72_D	81_V	1.166	0.85
54_T	57_E	1.161	0.84
63_T	68_H	1.154	0.84
31_D	46_P	1.152	0.84
18_P	46_P	1.124	0.82
6_V	13_P	1.068	0.77
20_T	35_I	1.068	0.77
62_I	68_H	1.051	0.75
22_M	25_L	1.03	0.73
30_D	52_V	1.001	0.70
40_G	45_E	1.001	0.70
37_L	40_G	1	0.70

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1mvfD	2	1	99.9	0.22	Contact Map	0.599
3zvkE	4	0.8902	99.3	0.504	Contact Map	0.608
3tndB	4	0.9146	98.9	0.589	Contact Map	0.515
3o27A	2	0.6585	98.8	0.604	Contact Map	0.481
1yfbA	2	0.6098	98.2	0.672	Contact Map	0.406
2l66A	2	0.6098	97.6	0.713	Contact Map	0.43
2w1tA	1	0.9878	96.2	0.763	Contact Map	0.225
2glwA	1	0.5122	44	0.874	Contact Map	0.295
1fr3A	12	0.561	25.2	0.889	Contact Map	0.281
1gutA	6	0.561	24.3	0.89	Contact Map	0.28

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0589 seconds.