OPENSEQ.org - CHPS - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

CHPS - Antitoxin ChpS

UniProt:	P08365	Sequence MRITIKRWGNSAGMVIPNIVMKELNLQPGQSVEAQVSNNQLILTPISRRYSLDELLAQCDMNAAELSEQDVWGKSTPAGDEIW	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG11250
Length:	83 (83)
Sequences:	277
Seq/Len:	3.34

CHPS
Paralog alert: 0.39 [within 20: 0.00] - ratio of genomes with paralogs
Cluster includes: CHPS MAZE

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
12_A	21_M	3.546	1.00
8_W	15_V	2.806	1.00
32_V	43_L	2.412	1.00
60_D	63_A	2.268	1.00
59_C	63_A	2.039	1.00
16_I	21_M	1.934	1.00
40_Q	44_T	1.904	1.00
52_L	56_L	1.88	0.99
6_K	29_G	1.763	0.99
8_W	11_S	1.66	0.98
8_W	13_G	1.625	0.98
12_A	28_P	1.603	0.98
18_N	22_K	1.538	0.97
10_N	15_V	1.518	0.97
37_S	40_Q	1.512	0.97
30_Q	45_P	1.405	0.94
21_M	28_P	1.362	0.93
11_S	15_V	1.359	0.93
10_N	13_G	1.351	0.93
50_Y	55_L	1.345	0.93
24_L	41_L	1.315	0.91
73_G	83_W	1.265	0.89
14_M	32_V	1.227	0.87
34_A	57_A	1.19	0.85
56_L	59_C	1.173	0.84
6_K	15_V	1.171	0.84
5_I	12_A	1.151	0.82
29_G	49_R	1.137	0.81
30_Q	67_S	1.104	0.78
14_M	41_L	1.102	0.78
55_L	58_Q	1.083	0.76
66_L	69_Q	1.062	0.74
1_M	10_N	1.054	0.74
21_M	24_L	1.05	0.73
6_K	30_Q	1.042	0.72
68_E	72_W	1.033	0.71
36_V	39_N	1.017	0.70
7_R	39_N	1.009	0.69
69_Q	73_G	1.009	0.69

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1mvfD	2	0.9518	99.8	0.27	Contact Map	0.642
3zvkE	4	0.8916	99.2	0.519	Contact Map	0.572
3tndB	4	0.8795	98.9	0.576	Contact Map	0.516
3o27A	2	0.6265	98.6	0.616	Contact Map	0.498
1yfbA	2	0.5904	98.2	0.661	Contact Map	0.385
2l66A	2	0.6145	97.6	0.702	Contact Map	0.459
2w1tA	1	0.9639	96.3	0.752	Contact Map	0.261
2glwA	1	0.5301	40.1	0.873	Contact Map	0.245
1fr3A	12	0.5422	22.7	0.887	Contact Map	0.314
3d31A	2	0.5301	22.3	0.888	Contact Map	0.178

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0145 seconds.