OPENSEQ.org - TFAS - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

TFAS - Putative tail fiber assembly protein homolog from prophage CPS-53

UniProt:	P77326	Sequence MILDRHITSRGYVCMRPATIAPLTPYDKWDGEKWVTDTEAQHSVAVDAAEAQRQSLIDTAMASISLIQLKLQAGRKLMQAETSRLNTVLDYIDAVTATDTSTAPDVIWPELPEE	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG14134
Length:	114 (110)
Sequences:	254
Seq/Len:	2.31

TFAS
Paralog alert: 0.67 [within 20: 0.10] - ratio of genomes with paralogs
Cluster includes: TFAS YFDK YMFS

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
69_L	92_I	2.749	1.00
52_Q	56_L	2.419	1.00
13_V	17_P	2.138	1.00
67_I	76_K	1.964	0.99
70_K	76_K	1.902	0.99
93_D	97_A	1.753	0.98
70_K	97_A	1.717	0.97
69_L	89_L	1.547	0.94
76_K	93_D	1.534	0.94
29_W	34_W	1.531	0.94
69_L	72_Q	1.518	0.94
67_I	70_K	1.465	0.92
72_Q	89_L	1.447	0.91
76_K	97_A	1.445	0.91
24_T	27_D	1.44	0.91
79_Q	82_T	1.425	0.90
89_L	92_I	1.42	0.90
76_K	81_E	1.395	0.89
68_Q	72_Q	1.372	0.88
29_W	37_D	1.362	0.88
27_D	36_T	1.35	0.87
81_E	97_A	1.342	0.86
102_T	111_L	1.32	0.85
70_K	93_D	1.315	0.85
14_C	17_P	1.275	0.82
70_K	75_R	1.263	0.82
69_L	76_K	1.263	0.82
71_L	76_K	1.26	0.81
42_H	46_V	1.258	0.81
67_I	93_D	1.251	0.81
50_E	53_R	1.242	0.80
60_A	88_V	1.237	0.80
95_V	98_T	1.231	0.79
24_T	36_T	1.22	0.78
50_E	100_T	1.216	0.78
94_A	97_A	1.211	0.78
72_Q	76_K	1.211	0.78
109_P	112_P	1.202	0.77
34_W	37_D	1.187	0.76
36_T	41_Q	1.175	0.75
11_G	34_W	1.172	0.74
11_G	29_W	1.163	0.74
81_E	93_D	1.16	0.73
18_A	29_W	1.132	0.71
67_I	89_L	1.114	0.69
83_S	107_I	1.094	0.67
46_V	62_A	1.09	0.66
11_G	18_A	1.073	0.65
9_S	14_C	1.072	0.65
18_A	22_P	1.066	0.64
89_L	93_D	1.066	0.64
69_L	73_A	1.063	0.64
22_P	27_D	1.063	0.64
37_D	40_A	1.06	0.63
11_G	22_P	1.052	0.62
81_E	96_T	1.045	0.62
11_G	37_D	1.043	0.61
67_I	71_L	1.036	0.61
67_I	97_A	1.036	0.61
26_Y	44_V	1.03	0.60
14_C	18_A	1.015	0.58
68_Q	89_L	1.013	0.58
70_K	96_T	1.012	0.58
51_A	55_S	1.005	0.57
76_K	89_L	1.004	0.57
22_P	37_D	1.001	0.57

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2kz6A	1	0.8158	99.5	0.586	Contact Map	0.158
1d0nA	2	0.3772	12.1	0.928	Contact Map	0.46
3al0C	1	0.5088	3.9	0.942	Contact Map	0.319
3i0yA	4	0.3509	3.5	0.944	Contact Map	0.372
2kt9A	1	0.7895	3.5	0.944	Contact Map	0.374
2fh1A	3	0.3772	2.7	0.947	Contact Map	0.613
3fg7A	2	0.386	2.1	0.95	Contact Map	0.532
3ip4C	1	0.5	1.9	0.951	Contact Map	0.212
1kblA	1	0.9123	1.9	0.951	Contact Map	0.198
1aqtA	1	0.7895	1.8	0.952	Contact Map	0.148

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.4314 seconds.