OPENSEQ.org - YAHO - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YAHO - Uncharacterized protein YahO

UniProt:	P75694	Sequence MKIISKMLVGALALAVTNVYAAELMTKAEFEKVESQYEKIGDISTSNEMSTADAKEDLIKKADEKGADVLVLTSGQTDNKIHGTANIYKKK	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13599
Length:	91 (86)
Sequences:	378
Seq/Len:	4.40

YAHO
Paralog alert: 0.97 [within 20: 0.46] - ratio of genomes with paralogs
Cluster includes: BHSA MCBA YAHO YBIJ YHCN YJFN YJFY

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
50_S	53_D	2.48	1.00
60_K	64_E	2.357	1.00
20_Y	24_L	2.014	1.00
67_A	87_I	1.884	1.00
13_A	17_T	1.741	0.99
77_T	81_I	1.652	0.99
8_L	14_L	1.62	0.99
22_A	25_M	1.596	0.99
23_E	26_T	1.544	0.98
39_K	86_N	1.542	0.98
51_T	83_G	1.539	0.98
15_A	18_N	1.506	0.98
45_T	54_A	1.471	0.98
38_E	71_V	1.464	0.98
56_E	60_K	1.449	0.97
50_S	57_D	1.408	0.97
59_I	63_D	1.405	0.97
68_D	89_K	1.393	0.96
73_T	84_T	1.382	0.96
54_A	75_G	1.336	0.95
43_I	63_D	1.32	0.95
72_L	75_G	1.281	0.94
55_K	72_L	1.268	0.93
52_A	87_I	1.259	0.93
49_M	54_A	1.212	0.91
13_A	16_V	1.211	0.91
4_I	7_M	1.181	0.89
60_K	63_D	1.18	0.89
71_V	86_N	1.167	0.89
54_A	77_T	1.164	0.89
1_M	5_S	1.149	0.88
1_M	9_V	1.147	0.88
26_T	35_S	1.118	0.86
5_S	12_L	1.11	0.85
54_A	81_I	1.101	0.85
59_I	86_N	1.069	0.82
5_S	9_V	1.051	0.81
25_M	34_E	1.042	0.80
18_N	33_V	1.021	0.78
34_E	37_Y	1.016	0.77
40_I	63_D	1.015	0.77
42_D	73_T	1.007	0.76

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2nocA	1	1	99.9	0.093	Contact Map	0.412
2jnaA	2	0.9451	99.9	0.154	Contact Map	0.385
2m2jA	1	0.9451	99.8	0.263	Contact Map	0.451
2ma4A	1	0.7692	99.8	0.273	Contact Map	0.372
4evuA	2	0.7582	99.8	0.327	Contact Map	0.534
2qgmA	1	0.8791	23.9	0.889	Contact Map	0.036
3b55A	1	0.8791	12.5	0.903	Contact Map	0.037
2jynA	1	0.5714	9.5	0.908	Contact Map	0.251
3sg0A	1	0.8571	8.1	0.91	Contact Map	0.072
4kzkA	1	0.9011	6.3	0.915	Contact Map	0.318

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 1.8257 seconds.