OPENSEQ.org - YQJD - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YQJD - Uncharacterized protein YqjD

UniProt:	P64581	Sequence MSKEHTTEHLRAELKSLSDTLEEVLSSSGEKSKEELSKIRSKAEQALKQSRYRLGETGDAIAKQTRVAAARADEYVRENPWTGVGIGAAIGVVLGVLLSRR	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12743
Length:	101 (101)
Sequences:	308
Seq/Len:	3.05

YQJD
Paralog alert: 0.88 [within 20: 0.01] - ratio of genomes with paralogs
Cluster includes: ELAB YGAM YQJD

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
75_Y	81_W	2.443	1.00
87_G	91_G	2.072	1.00
93_V	98_L	1.751	0.99
2_S	5_H	1.59	0.97
17_L	51_R	1.538	0.96
83_G	87_G	1.508	0.96
3_K	6_T	1.474	0.95
14_L	18_S	1.457	0.95
97_L	101_R	1.424	0.94
52_Y	74_E	1.415	0.94
83_G	92_V	1.413	0.94
10_L	54_L	1.408	0.93
62_A	66_R	1.379	0.93
73_D	77_R	1.374	0.92
81_W	84_V	1.339	0.91
76_V	79_N	1.333	0.91
92_V	98_L	1.325	0.90
2_S	6_T	1.315	0.90
1_M	4_E	1.309	0.90
36_L	65_T	1.307	0.90
95_G	100_R	1.306	0.90
35_E	38_K	1.295	0.89
76_V	84_V	1.279	0.88
9_H	58_G	1.278	0.88
73_D	92_V	1.26	0.87
42_K	90_I	1.252	0.87
15_K	69_A	1.243	0.86
43_A	46_A	1.233	0.86
90_I	98_L	1.22	0.85
23_E	76_V	1.207	0.84
20_T	85_G	1.202	0.84
52_Y	90_I	1.201	0.84
43_A	74_E	1.199	0.83
24_V	72_A	1.197	0.83
51_R	66_R	1.193	0.83
9_H	41_S	1.173	0.82
22_E	51_R	1.161	0.81
84_V	88_A	1.139	0.79
1_M	5_H	1.112	0.77
32_S	36_L	1.111	0.76
20_T	23_E	1.104	0.76
40_R	51_R	1.093	0.75
79_N	82_T	1.062	0.72
22_E	78_E	1.048	0.70
40_R	81_W	1.046	0.70
14_L	99_S	1.039	0.69
60_A	73_D	1.038	0.69
28_S	58_G	1.029	0.68
89_A	92_V	1.027	0.68
45_Q	48_K	1.026	0.68
24_V	28_S	1.025	0.68
25_L	81_W	1.024	0.68
35_E	91_G	1.019	0.67
54_L	101_R	1.012	0.66
4_E	7_T	1.01	0.66
34_E	37_S	1.004	0.66
13_E	35_E	1.004	0.66
35_E	42_K	1.004	0.66
25_L	33_K	1.001	0.65

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results:

PDB	Chains	Cov	P(%)	HHΔ		Acc
4dndA	1	0.8119	30.6	0.89	Contact Map	0.242
3obvE	4	0.9802	22.7	0.896	Contact Map	0.144
4j42A	2	0.7426	22.7	0.896	Contact Map	0.337
2lomA	1	0.4752	20	0.899	Contact Map	0.161
2qywA	1	0.7921	18.8	0.9	Contact Map	0.289
1gs9A	1	0.703	18.5	0.9	Contact Map	0.252
1v9dA	4	0.9802	16.3	0.903	Contact Map	0.207
3mq9A	8	0.5743	15.7	0.904	Contact Map	0.311
4aurA	1	1	15.2	0.904	Contact Map	0.063
2lonA	1	0.495	13	0.907	Contact Map	0.112

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.8837 seconds.