OPENSEQ.org - ETP - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

ETP - Low molecular weight protein-tyrosine-phosphatase etp

UniProt:	P0ACZ2	Sequence MAQLKFNSILVVCTGNICRSPIGERLLRKRLPGVKVKSAGVHGLVKHPADATAADVAANHGVSLEGHAGRKLTAEMARNYDLILAMESEHIAQVTAIAPEVRGKTMLFGQWLEQKEIPDPYRKSQDAFEHVYGMLERASQEWAKRLSR	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13727
Length:	148 (142)
Sequences:	3578
Seq/Len:	25.20

ETP
Paralog alert: 0.52 [within 20: 0.03] - ratio of genomes with paralogs
Cluster includes: ETP WZB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
30_R	140_Q	3.21	1.00
24_E	28_R	2.675	1.00
72_L	94_V	2.578	1.00
57_A	64_L	2.553	1.00
118_P	134_M	2.553	1.00
8_S	35_K	2.516	1.00
136_E	140_Q	2.359	1.00
59_N	129_E	2.277	1.00
28_R	36_V	2.177	1.00
60_H	132_Y	2.029	1.00
14_T	90_H	2.02	1.00
22_I	57_A	2.003	1.00
60_H	136_E	1.976	1.00
30_R	136_E	1.926	1.00
85_A	94_V	1.92	1.00
11_V	27_L	1.779	1.00
26_L	60_H	1.67	1.00
56_V	132_Y	1.644	1.00
26_L	135_L	1.621	1.00
22_I	53_A	1.591	1.00
37_K	70_R	1.586	1.00
55_D	125_Q	1.58	1.00
10_L	39_A	1.574	1.00
88_S	116_E	1.568	1.00
9_I	27_L	1.559	1.00
85_A	91_I	1.531	1.00
123_K	127_A	1.483	1.00
25_R	62_V	1.481	1.00
52_T	55_D	1.386	0.99
27_L	36_V	1.365	0.99
43_G	71_K	1.361	0.99
15_G	121_Y	1.353	0.99
11_V	139_S	1.334	0.99
56_V	129_E	1.334	0.99
31_L	34_V	1.325	0.99
108_F	139_S	1.313	0.99
49_A	54_A	1.302	0.99
130_H	134_M	1.297	0.99
37_K	80_Y	1.297	0.99
82_L	142_W	1.283	0.99
60_H	133_G	1.268	0.99
106_M	111_W	1.258	0.99
117_I	131_V	1.242	0.98
49_A	67_H	1.242	0.98
55_D	59_N	1.233	0.98
25_R	64_L	1.224	0.98
53_A	128_F	1.221	0.98
124_S	127_A	1.214	0.98
109_G	112_L	1.212	0.98
108_F	135_L	1.192	0.98
125_Q	129_E	1.186	0.98
56_V	60_H	1.183	0.98
54_A	64_L	1.156	0.97
41_V	93_Q	1.145	0.97
26_L	132_Y	1.141	0.97
26_L	136_E	1.118	0.96
31_L	143_A	1.118	0.96
141_E	144_K	1.114	0.96
50_D	128_F	1.108	0.96
75_E	79_N	1.105	0.96
31_L	36_V	1.096	0.96
129_E	133_G	1.096	0.96
64_L	67_H	1.093	0.96
45_V	69_G	1.093	0.96
56_V	59_N	1.086	0.96
14_T	42_H	1.081	0.95
13_C	16_N	1.077	0.95
35_K	79_N	1.074	0.95
8_S	80_Y	1.057	0.95
137_R	141_E	1.055	0.95
16_N	20_S	1.048	0.94
30_R	139_S	1.045	0.94
11_V	23_G	1.041	0.94
54_A	58_A	1.038	0.94
62_V	136_E	1.028	0.94
91_I	95_T	1.022	0.93
26_L	139_S	1.006	0.93

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2wmyA	8	1	100	0.031	Contact Map	0.843
2wjaA	2	1	100	0.033	Contact Map	0.839
2fekA	1	1	100	0.053	Contact Map	0.715
4etnA	1	0.9932	100	0.079	Contact Map	0.816
4egsA	2	0.9865	100	0.089	Contact Map	0.834
2cwdA	4	0.9797	100	0.089	Contact Map	0.877
1p8aA	1	0.9595	100	0.094	Contact Map	0.537
3jviA	1	0.9797	100	0.096	Contact Map	0.765
1d1qA	2	0.9865	100	0.103	Contact Map	0.85
2gi4A	1	0.9527	100	0.105	Contact Map	0.426

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.4769 seconds.