OPENSEQ.org - ARNE - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

ARNE - Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE

UniProt:	Q47377	Sequence MIWLTLVFASLLSVAGQLCQKQATCFVAINKRRKHIVLWLGLALACLGLAMVLWLLVLQNVPVGIAYPMLSLNFVWVTLAAVKLWHEPVSPRHWCGVAFIIGGIVILGSTV	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG14344
Length:	111 (110)
Sequences:	503
Seq/Len:	4.57

ARNE
Paralog alert: 0.76 [within 20: 0.36] - ratio of genomes with paralogs
Cluster includes: ARNE ARNF

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
23_A	40_L	2.057	1.00
89_V	94_W	1.876	1.00
98_A	102_G	1.853	1.00
99_F	102_G	1.709	0.99
9_A	70_L	1.708	0.99
24_T	55_L	1.677	0.99
99_F	106_I	1.66	0.99
79_L	83_K	1.634	0.99
6_L	61_V	1.55	0.99
17_Q	71_S	1.517	0.98
61_V	66_A	1.51	0.98
13_S	70_L	1.486	0.98
78_T	93_H	1.472	0.98
9_A	57_V	1.438	0.97
17_Q	54_W	1.389	0.97
46_C	49_L	1.388	0.97
91_P	95_C	1.361	0.96
16_G	70_L	1.354	0.96
72_L	75_V	1.353	0.96
13_S	51_M	1.334	0.96
13_S	16_G	1.329	0.95
18_L	22_Q	1.328	0.95
90_S	93_H	1.303	0.95
9_A	13_S	1.295	0.94
83_K	95_C	1.23	0.92
69_M	74_F	1.217	0.92
54_W	67_Y	1.215	0.92
50_A	70_L	1.2	0.91
92_R	95_C	1.188	0.90
3_W	7_V	1.163	0.89
23_A	43_A	1.154	0.89
78_T	81_A	1.148	0.88
74_F	107_L	1.147	0.88
17_Q	72_L	1.141	0.88
42_L	45_A	1.138	0.88
80_A	84_L	1.127	0.87
77_V	81_A	1.121	0.87
41_G	49_L	1.118	0.86
32_R	80_A	1.11	0.86
72_L	81_A	1.101	0.85
17_Q	21_K	1.098	0.85
13_S	73_N	1.094	0.85
23_A	93_H	1.079	0.84
10_S	14_V	1.079	0.84
21_K	106_I	1.078	0.84
31_K	52_V	1.071	0.83
41_G	86_H	1.065	0.83
63_V	107_L	1.061	0.82
13_S	20_Q	1.046	0.81
54_W	72_L	1.046	0.81
20_Q	73_N	1.038	0.80
54_W	69_M	1.037	0.80
105_V	109_S	1.035	0.80
46_C	107_L	1.028	0.79
23_A	74_F	1.021	0.79
3_W	6_L	1.018	0.79
42_L	49_L	1.013	0.78
97_V	101_I	1.011	0.78
13_S	57_V	1.011	0.78
35_H	45_A	1.008	0.78

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2i68A	2	0.9279	99.7	0.428	Contact Map	0.016
3b5dA	2	0.9279	99.7	0.432	Contact Map	0.071
4gx0A	4	0.8378	1.1	0.947	Contact Map	0.477
3ar4A	1	0.8198	1	0.949	Contact Map	0.526
2lk9A	1	0.2252	0.7	0.953	Contact Map	0.031
4h44F	1	0.1982	0.7	0.955	Contact Map	0.263
2wscL	1	0.5766	0.7	0.955	Contact Map	0.061
4kjrA	2	0.5495	0.6	0.955	Contact Map	0.252
3j01B	1	0.4595	0.6	0.956	Contact Map	0.186
2ri9A	2	0.3153	0.6	0.957	Contact Map	0.468

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0607 seconds.