OPENSEQ.org - RL362 - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

RL362 - 50S ribosomal protein L36 2

UniProt:	Q2EEQ2	Sequence MKVLNSLRTAKERHPDCQIVKRKGRLYVICKSNPRFKAVQGRKKKR	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG14432
Length:	46 (41)
Sequences:	633
Seq/Len:	15.44

RL362
Paralog alert: 0.23 [within 20: 0.00] - ratio of genomes with paralogs
Cluster includes: RL362 RL36

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
16_D	31_K	3.989	1.00
15_P	33_N	2.274	1.00
20_V	27_Y	1.862	1.00
14_H	36_F	1.801	1.00
14_H	30_C	1.74	1.00
30_C	36_F	1.609	1.00
24_G	31_K	1.403	0.99
19_I	28_V	1.366	0.99
10_A	30_C	1.33	0.99
17_C	30_C	1.309	0.99
16_D	32_S	1.289	0.99
3_V	19_I	1.239	0.98
3_V	23_K	1.182	0.98
24_G	39_V	1.157	0.97
7_L	11_K	1.134	0.97
14_H	32_S	1.081	0.95
7_L	36_F	1.061	0.95
8_R	31_K	1.055	0.95
3_V	39_V	1.041	0.94
31_K	34_P	1.02	0.93
10_A	17_C	1.012	0.93

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
3bbo6	1	0.9348	99.7	0.094	Contact Map	0.381
4kix4	1	0.8261	99.6	0.132	Contact Map	0.567
2zjr4	1	0.8043	99.6	0.158	Contact Map	0.577
3py7A	1	0.5217	1.6	0.909	Contact Map	0
1qzvF	2	0.5217	1.4	0.912	Contact Map
1cz6A	1	0.5435	1.3	0.913	Contact Map	0.276
1ileA	1	0.3478	1.1	0.917	Contact Map	0
3oa5A	2	0.4348	1	0.921	Contact Map
3hkwA	3	0.8043	0.9	0.921	Contact Map	0
4etsA	2	0.5652	0.9	0.922	Contact Map	0.153

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0458 seconds.