OPENSEQ.org - LYSD - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

LYSD - Lysozyme RrrD

UniProt:	P78285	Sequence MPPSLRKAVAAAIGGGAIAIASVLITGPSGNDGLEGVSYIPYKDIVGVWTVCHGHTGKDIMLGKTYTKAECKALLNKDLATVARQINPYIKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGLMTRREIEREVCLWGQQ	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13635
Length:	165 (154)
Sequences:	713
Seq/Len:	4.63

LYSD
Paralog alert: 0.57 [within 20: 0.03] - ratio of genomes with paralogs
Cluster includes: LYSD LYSQ

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
96_E	100_G	3.953	1.00
127_D	130_G	3.667	1.00
55_H	78_D	3.373	1.00
134_Q	137_R	3.065	1.00
95_P	98_T	2.647	1.00
122_K	134_Q	2.457	1.00
49_W	62_L	2.222	1.00
132_C	160_C	2.215	1.00
139_T	145_Q	2.125	1.00
85_Q	111_A	2.046	1.00
37_V	53_H	2.037	1.00
133_D	157_R	1.973	1.00
48_V	56_T	1.957	1.00
105_F	109_V	1.933	1.00
157_R	161_L	1.93	1.00
119_L	134_Q	1.906	1.00
45_I	146_W	1.875	1.00
89_Y	115_R	1.871	1.00
43_K	49_W	1.823	1.00
52_C	71_C	1.728	0.99
139_T	150_M	1.724	0.99
122_K	130_G	1.692	0.99
104_S	156_E	1.614	0.99
147_K	151_T	1.561	0.99
41_P	63_G	1.551	0.99
117_S	138_W	1.542	0.99
34_L	151_T	1.501	0.98
122_K	127_D	1.422	0.97
66_Y	71_C	1.42	0.97
46_V	141_A	1.414	0.97
68_K	72_K	1.406	0.97
41_P	64_K	1.374	0.96
55_H	74_L	1.359	0.96
140_Y	145_Q	1.347	0.96
51_V	66_Y	1.343	0.96
83_A	103_Y	1.323	0.95
136_R	157_R	1.323	0.95
55_H	107_Y	1.317	0.95
90_I	123_I	1.292	0.95
94_I	123_I	1.266	0.94
153_R	156_E	1.263	0.94
145_Q	150_M	1.259	0.93
82_V	106_V	1.252	0.93
114_F	120_L	1.247	0.93
53_H	75_L	1.226	0.92
90_I	94_I	1.209	0.92
136_R	154_E	1.207	0.91
141_A	146_W	1.203	0.91
105_F	114_F	1.186	0.91
44_D	47_G	1.182	0.90
59_D	64_K	1.16	0.89
134_Q	138_W	1.156	0.89
53_H	71_C	1.148	0.89
91_K	124_N	1.13	0.87
87_N	99_R	1.125	0.87
119_L	137_R	1.102	0.86
90_I	102_L	1.102	0.86
98_T	128_I	1.097	0.85
9_V	14_G	1.097	0.85
90_I	120_L	1.096	0.85
41_P	51_V	1.095	0.85
61_M	64_K	1.091	0.85
34_L	155_I	1.086	0.85
109_V	114_F	1.08	0.84
60_I	64_K	1.065	0.83
133_D	161_L	1.059	0.82
39_Y	68_K	1.054	0.82
92_V	123_I	1.053	0.82
96_E	99_R	1.044	0.81
70_E	74_L	1.036	0.80
39_Y	71_C	1.028	0.80
52_C	66_Y	1.027	0.80
44_D	48_V	1.009	0.78
117_S	120_L	1.008	0.78
37_V	68_K	1.008	0.78
64_K	70_E	1.004	0.78
6_R	15_G	1	0.77

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
3hdeA	4	1	100	0.073	Contact Map	0.842
3hdfA	2	0.8485	100	0.17	Contact Map	0.635
1xjtA	1	0.9939	100	0.18	Contact Map	0.755
1xjuA	2	0.8667	100	0.211	Contact Map	0.598
2anvA	2	0.8606	100	0.215	Contact Map	0.761
4httA	2	0.9212	100	0.319	Contact Map
1swyA	1	0.8242	100	0.33	Contact Map	0.622
4e97A	2	0.897	100	0.332	Contact Map	0.625
4epiA	1	0.9455	100	0.352	Contact Map	0.622
1wthA	1	0.9333	100	0.358	Contact Map	0.667

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0509 seconds.