OPENSEQ.org - YBCL - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YBCL - UPF0098 protein YbcL

UniProt:	P77368	Sequence MKTLIVSTVLAFITFSAQAAAFQVTSNEIKTGEQLTTSHVFSGFGCEGGNTSPSLTWSGVPEGTKSFAVTVYDPDAPTGSGWWHWTVVNIPATVTYLPVDAGRRDGTKLPTGAVQGRNDFGYAGFGGACPPKGDKPHHYQFKVWALKTEKIPVDSNSSGALVGYMLNANKIATAEITPVYEIK	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13628
Length:	183 (166)
Sequences:	1146
Seq/Len:	6.90

YBCL
Paralog alert: 0.29 [within 20: 0.02] - ratio of genomes with paralogs
Cluster includes: YBCL YBHB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
147_K	169_N	5.526	1.00
46_C	129_C	4.065	1.00
60_V	67_F	3.832	1.00
69_V	143_V	3.362	1.00
89_N	152_P	3.199	1.00
120_F	126_G	2.56	1.00
71_V	141_F	2.522	1.00
27_N	54_S	2.516	1.00
22_F	174_A	2.329	1.00
34_Q	179_V	2.267	1.00
28_E	99_V	2.261	1.00
67_F	92_A	2.219	1.00
28_E	54_S	2.189	1.00
24_V	143_V	2.123	1.00
29_I	178_P	2.069	1.00
52_S	97_L	2.053	1.00
68_A	162_V	1.996	1.00
140_Q	177_T	1.945	1.00
35_L	128_A	1.931	1.00
65_K	149_E	1.886	1.00
38_S	99_V	1.849	1.00
57_W	97_L	1.819	1.00
30_K	33_E	1.789	1.00
50_N	127_G	1.756	1.00
146_L	166_L	1.741	1.00
26_S	55_L	1.74	1.00
142_K	175_E	1.736	1.00
116_G	162_V	1.685	1.00
56_T	96_Y	1.604	1.00
162_V	166_L	1.568	1.00
24_V	174_A	1.55	0.99
60_V	95_T	1.548	0.99
35_L	178_P	1.547	0.99
26_S	176_I	1.475	0.99
29_I	36_T	1.463	0.99
75_D	138_H	1.457	0.99
47_E	182_I	1.438	0.99
102_G	115_Q	1.413	0.99
88_V	162_V	1.41	0.99
54_S	96_Y	1.404	0.99
166_L	170_K	1.397	0.99
34_Q	181_E	1.395	0.99
88_V	116_G	1.388	0.99
22_F	59_G	1.371	0.98
61_P	145_A	1.332	0.98
87_V	113_A	1.314	0.98
39_H	99_V	1.282	0.97
89_N	150_K	1.279	0.97
73_D	84_H	1.275	0.97
125_F	128_A	1.248	0.97
22_F	60_V	1.228	0.96
165_M	168_A	1.225	0.96
98_P	101_A	1.215	0.96
142_K	173_T	1.203	0.96
88_V	157_S	1.199	0.96
24_V	55_L	1.189	0.95
64_T	67_F	1.18	0.95
86_T	116_G	1.169	0.95
89_N	114_V	1.154	0.94
140_Q	175_E	1.153	0.94
136_P	181_E	1.145	0.94
135_K	181_E	1.141	0.94
23_Q	58_S	1.139	0.94
143_V	174_A	1.136	0.94
60_V	64_T	1.116	0.93
68_A	166_L	1.11	0.93
61_P	64_T	1.098	0.92
67_F	95_T	1.094	0.92
110_P	113_A	1.091	0.92
144_W	170_K	1.073	0.91
41_F	126_G	1.063	0.90
38_S	49_G	1.062	0.90
66_S	148_T	1.048	0.89
86_T	162_V	1.046	0.89
116_G	159_G	1.038	0.89
115_Q	124_G	1.03	0.88
148_T	169_N	1.011	0.87
43_G	99_V	1.006	0.87

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1fuxA	2	0.8962	100	0.22	Contact Map	0.83
1fjjA	1	0.8689	100	0.246	Contact Map	0.891
4begA	2	0.9344	100	0.255	Contact Map	0.814
3n08A	2	0.8142	100	0.279	Contact Map	0.817
2evvA	4	0.9399	100	0.346	Contact Map	0.773
1wpxB	1	0.9672	100	0.572	Contact Map	0.31
2jyzA	1	0.8087	99.9	0.602	Contact Map	0.251
2gzqA	1	0.847	99.9	0.62	Contact Map	0.452
2iqyA	1	0.8033	99.9	0.628	Contact Map	0.389
3axyA	4	0.7869	99.9	0.635	Contact Map	0.417

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.047 seconds.