OPENSEQ.org - YEAK - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YEAK - Uncharacterized protein YeaK

UniProt:	P64483	Sequence MTEMAKGSVTHQRLIALLSQEGADFRVVTHEAVGKCEAVSEIRGTALGQGAKALVCKVKGNGVNQHVLAILAADQQADLSQLASHIGGLRASLASPAEVDELTGCVFGAIPPFSFHPKLKLVADPLLFERFDEIAFNAGMLDKSVILKTADYLRIAQPELVNFRRTA	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13497
Length:	167 (152)
Sequences:	2293
Seq/Len:	15.09

YEAK
Paralog alert: 0.50 [within 20: 0.01] - ratio of genomes with paralogs
Cluster includes: YBAK YEAK

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
133_E	146_I	3.235	1.00
19_S	25_F	2.767	1.00
151_D	154_R	2.622	1.00
99_V	110_I	2.586	1.00
65_Q	120_K	2.583	1.00
57_K	98_E	2.526	1.00
148_K	151_D	2.478	1.00
86_I	122_V	2.472	1.00
81_Q	162_N	2.356	1.00
153_L	160_L	2.288	1.00
85_H	161_V	2.196	1.00
128_F	160_L	2.092	1.00
125_P	162_N	2.078	1.00
78_D	165_R	2.039	1.00
69_A	82_L	2.024	1.00
26_R	146_I	1.983	1.00
17_L	21_E	1.917	1.00
125_P	129_E	1.915	1.00
49_Q	131_F	1.84	1.00
95_S	98_E	1.761	1.00
28_V	146_I	1.747	1.00
135_A	146_I	1.729	1.00
66_H	102_L	1.698	1.00
21_E	155_I	1.666	1.00
58_V	88_G	1.621	1.00
78_D	81_Q	1.609	1.00
37_E	41_E	1.591	1.00
67_V	82_L	1.562	1.00
36_C	73_A	1.547	1.00
16_A	20_Q	1.484	1.00
132_D	148_K	1.459	1.00
69_A	163_F	1.439	1.00
138_A	144_S	1.422	1.00
24_D	151_D	1.42	1.00
51_A	127_L	1.398	0.99
55_V	119_L	1.393	0.99
58_V	65_Q	1.391	0.99
38_A	42_I	1.388	0.99
56_C	82_L	1.374	0.99
46_A	49_Q	1.362	0.99
75_Q	164_R	1.36	0.99
118_K	157_Q	1.357	0.99
153_L	158_P	1.348	0.99
98_E	102_L	1.341	0.99
51_A	70_I	1.307	0.99
96_P	107_F	1.289	0.99
48_G	131_F	1.268	0.99
122_V	163_F	1.242	0.98
125_P	128_F	1.233	0.98
16_A	19_S	1.231	0.98
115_F	121_L	1.228	0.98
17_L	20_Q	1.218	0.98
12_Q	16_A	1.213	0.98
128_F	150_A	1.21	0.98
124_D	164_R	1.196	0.98
66_H	94_A	1.189	0.98
56_C	67_V	1.183	0.98
48_G	74_D	1.176	0.98
136_F	147_L	1.151	0.97
68_L	115_F	1.144	0.97
26_R	133_E	1.103	0.96
126_L	129_E	1.101	0.96
35_K	38_A	1.098	0.96
56_C	77_A	1.096	0.96
80_S	84_S	1.09	0.96
88_G	91_A	1.084	0.96
23_A	155_I	1.078	0.95
31_E	42_I	1.076	0.95
57_K	66_H	1.076	0.95
99_V	107_F	1.064	0.95
59_K	64_N	1.059	0.95
112_P	152_Y	1.05	0.94
45_T	135_A	1.049	0.94
59_K	63_V	1.048	0.94
150_A	153_L	1.046	0.94
100_D	106_V	1.044	0.94
150_A	154_R	1.043	0.94
67_V	88_G	1.03	0.94
32_A	35_K	1.023	0.93
58_V	91_A	1.014	0.93
71_L	163_F	1.011	0.93
18_L	25_F	1.004	0.93

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1vjfA	1	0.976	100	0.235	Contact Map	0.607
3op6A	2	0.9042	100	0.235	Contact Map	0.703
2z0xA	1	0.9281	100	0.238	Contact Map	0.679
1vkiA	2	0.9461	100	0.24	Contact Map	0.661
1dbuA	1	0.9222	100	0.243	Contact Map	0.727
1wdvA	2	0.9042	100	0.244	Contact Map	0.796
2dxaA	1	0.9701	100	0.244	Contact Map	0.762
3memA	1	0.8443	100	0.349	Contact Map	0.54
2j3lA	2	0.9701	97.6	0.815	Contact Map	0.751
1v4rA	1	0.5689	30.9	0.926	Contact Map	0.367

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0475 seconds.