OPENSEQ.org - YHBS - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YHBS - Uncharacterized N-acetyltransferase YhbS

UniProt:	P63417	Sequence MLIRVEIPIDAPGIDALLRRSFESDAEAKLVHDLREDGFLTLGLVATDDEGQVIGYVAFSPVDVQGEDLQWVGMAPLAVDEKYRGQGLARQLVYEGLDSLNEFGYAAVVTLGDPALYSRFGFELAAHHDLRCRWPGTESAFQVHRLADDALNGVTGLVEYHEHFNRF	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12788
Length:	167 (166)
Sequences:	942
Seq/Len:	5.67

YHBS
Paralog alert: 0.24 [within 20: 0.02] - ratio of genomes with paralogs
Cluster includes: YHBS YJHQ

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
59_F	96_G	5.44	1.00
97_L	108_V	3.636	1.00
77_L	93_V	3.432	1.00
97_L	122_F	2.994	1.00
18_L	78_A	2.823	1.00
15_D	32_H	2.45	1.00
113_D	118_S	2.283	1.00
95_E	99_S	2.249	1.00
6_E	43_G	2.028	1.00
72_V	100_L	1.973	1.00
56_Y	78_A	1.945	1.00
4_R	10_D	1.915	1.00
90_R	119_R	1.913	1.00
81_E	84_R	1.871	1.00
90_R	120_F	1.791	1.00
95_E	98_D	1.773	1.00
99_S	102_E	1.765	1.00
118_S	142_Q	1.722	1.00
54_I	88_L	1.7	1.00
73_G	160_Y	1.692	1.00
17_L	53_V	1.62	0.99
145_R	149_D	1.59	0.99
44_L	95_E	1.564	0.99
4_R	47_T	1.561	0.99
57_V	96_G	1.536	0.99
160_Y	164_F	1.529	0.99
62_V	158_V	1.525	0.99
46_A	88_L	1.489	0.99
45_V	53_V	1.461	0.99
111_L	160_Y	1.426	0.98
71_W	107_A	1.423	0.98
20_R	80_D	1.417	0.98
74_M	93_V	1.405	0.98
25_D	28_A	1.4	0.98
114_P	140_A	1.375	0.98
73_G	164_F	1.335	0.97
72_V	105_Y	1.328	0.97
18_L	56_Y	1.316	0.97
15_D	19_R	1.29	0.96
6_E	35_R	1.29	0.96
74_M	110_T	1.289	0.96
47_T	51_G	1.285	0.96
79_V	88_L	1.267	0.96
116_L	120_F	1.256	0.95
106_A	147_A	1.252	0.95
141_F	164_F	1.232	0.95
111_L	141_F	1.231	0.95
30_L	75_A	1.23	0.95
64_V	156_G	1.219	0.94
83_Y	86_Q	1.215	0.94
37_D	161_H	1.202	0.94
57_V	77_L	1.184	0.93
57_V	92_L	1.17	0.93
80_D	83_Y	1.16	0.92
126_A	138_E	1.145	0.92
18_L	31_V	1.136	0.91
123_E	127_H	1.133	0.91
125_A	129_D	1.132	0.91
90_R	94_Y	1.13	0.91
48_D	83_Y	1.129	0.91
120_F	144_H	1.129	0.91
76_P	117_Y	1.127	0.91
44_L	96_G	1.124	0.91
25_D	29_K	1.122	0.90
33_D	166_R	1.117	0.90
19_R	28_A	1.116	0.90
75_A	110_T	1.112	0.90
89_A	116_L	1.105	0.90
57_V	93_V	1.104	0.89
98_D	101_N	1.103	0.89
50_E	81_E	1.088	0.89
59_F	100_L	1.07	0.87
73_G	141_F	1.063	0.87
74_M	108_V	1.062	0.87
30_L	132_C	1.046	0.86
123_E	145_R	1.04	0.85
52_Q	80_D	1.037	0.85
125_A	143_V	1.031	0.85
93_V	120_F	1.024	0.84
15_D	28_A	1.016	0.83
100_L	130_L	1.013	0.83
2_L	47_T	1.01	0.83
3_I	44_L	1.009	0.83
39_F	161_H	1.007	0.83
44_L	99_S	1.002	0.82

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1cjwA	1	0.8443	99.6	0.668	Contact Map	0.679
3te4A	1	0.8743	99.6	0.67	Contact Map	0.727
1n71A	4	0.8683	99.6	0.671	Contact Map	0.788
1kuxA	1	0.9102	99.6	0.672	Contact Map	0.698
3sxnA	6	1	99.6	0.678	Contact Map	0.732
3r1kA	1	1	99.6	0.678	Contact Map	0.669
3n7zA	6	0.994	99.6	0.68	Contact Map	0.729
3efaA	1	0.8263	99.6	0.681	Contact Map	0.563
2hv2A	6	0.994	99.6	0.683	Contact Map	0.705
2i00A	6	0.994	99.6	0.684	Contact Map	0.725

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0233 seconds.