OPENSEQ.org - YQJF - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YQJF - Inner membrane protein YqjF

UniProt:	P42619	Sequence MKKLEDVGVLVARILMPILFITAGWGKITGYAGTQQYMEAMGVPGFMLPLVILLEFGGGLAILFGFLTRTTALFTAGFTLLTAFLFHSNFAEGVNSLMFMKNLTISGGFLLLAITGPGAYSIDRLLNKKW	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12745
Length:	130 (126)
Sequences:	569
Seq/Len:	4.52

YQJF
Paralog alert: 0.50 [within 20: 0.01] - ratio of genomes with paralogs
Cluster includes: YPHA YQJF

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
94_V	98_M	2.67	1.00
61_A	71_T	2.063	1.00
31_Y	49_P	2.046	1.00
111_L	115_T	1.901	1.00
88_S	91_A	1.882	1.00
23_A	78_F	1.803	1.00
78_F	107_G	1.765	1.00
19_L	105_I	1.694	0.99
83_A	106_S	1.619	0.99
30_G	33_G	1.595	0.99
25_W	56_F	1.594	0.99
12_A	111_L	1.537	0.98
117_P	123_D	1.528	0.98
17_P	21_I	1.519	0.98
38_M	86_F	1.45	0.98
28_I	52_I	1.412	0.97
31_Y	38_M	1.4	0.97
9_V	115_T	1.396	0.97
31_Y	52_I	1.351	0.96
17_P	62_I	1.35	0.96
38_M	48_L	1.301	0.95
31_Y	35_Q	1.249	0.93
44_P	110_L	1.247	0.93
53_L	57_G	1.245	0.93
89_N	92_E	1.241	0.93
87_H	95_N	1.231	0.92
8_G	124_R	1.23	0.92
79_T	105_I	1.219	0.92
117_P	121_S	1.212	0.91
12_A	24_G	1.2	0.91
54_L	58_G	1.192	0.90
17_P	59_G	1.192	0.90
27_K	55_E	1.189	0.90
12_A	114_I	1.188	0.90
14_I	21_I	1.185	0.90
11_V	14_I	1.182	0.90
24_G	50_L	1.162	0.89
23_A	97_L	1.16	0.89
80_L	84_F	1.159	0.89
17_P	104_T	1.158	0.89
96_S	100_M	1.153	0.88
76_A	110_L	1.146	0.88
26_G	29_T	1.141	0.88
37_Y	40_A	1.14	0.88
82_T	97_L	1.136	0.87
97_L	100_M	1.135	0.87
28_I	56_F	1.125	0.87
73_L	113_A	1.111	0.86
38_M	41_M	1.1	0.85
37_Y	101_K	1.089	0.84
55_E	79_T	1.089	0.84
68_T	112_L	1.081	0.84
83_A	99_F	1.08	0.84
34_T	86_F	1.079	0.83
18_I	110_L	1.079	0.83
16_M	84_F	1.077	0.83
45_G	48_L	1.073	0.83
10_L	14_I	1.072	0.83
68_T	123_D	1.071	0.83
58_G	71_T	1.064	0.82
20_F	23_A	1.054	0.81
52_I	57_G	1.051	0.81
37_Y	102_N	1.038	0.80
9_V	112_L	1.034	0.80
24_G	54_L	1.026	0.79
67_L	106_S	1.025	0.79
77_G	81_L	1.024	0.79
98_M	105_I	1.022	0.79
67_L	70_T	1.018	0.78
54_L	62_I	1.013	0.78
78_F	83_A	1.011	0.78

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results:

PDB	Chains	Cov	P(%)	HHΔ		Acc
1vkmA	6	0.8	3.4	0.942	Contact Map	0.318
4gimA	3	0.7923	2.4	0.946	Contact Map	0.196
4ex8A	1	0.8	2.3	0.947	Contact Map	0.304
3j27A	3	0.4	2	0.948	Contact Map	0.446
4cbfA	2	0.4	1.9	0.949	Contact Map	0.036
4azxA	3	0.4	1.9	0.949	Contact Map	0.083
2l9uA	2	0.2846	1.5	0.952	Contact Map	0.621
2w0yA	2	0.3692	1.3	0.953	Contact Map
1xkpB	1	0.3231	1.3	0.954	Contact Map	0.247
3heqA	2	0.3769	1.2	0.955	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0216 seconds.