OPENSEQ.org - HYCI - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

HYCI - Hydrogenase 3 maturation protease

UniProt:	P0AEV9	Sequence MTDVLLCVGNSMMGDDGAGPLLAEKCAAAPKGNWVVIDGGSAPENDIVAIRELRPTRLLIVDATDMGLNPGEIRIIDPDDIAEMFMMTTHNMPLNYLIDQLKEDIGEVIFLGIQPDIVGFYYPMTQPIKDAVETVYQRLEGWEGNGGFAQLAVEEE	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13396
Length:	156 (151)
Sequences:	825
Seq/Len:	5.46

HYCI
Paralog alert: 0.60 [within 20: 0.02] - ratio of genomes with paralogs
Cluster includes: HYAD HYBD HYCI

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
116_D	127_P	5.334	1.00
23_A	36_V	3.465	1.00
65_D	114_Q	2.522	1.00
61_V	139_L	2.418	1.00
18_A	113_I	2.411	1.00
22_L	61_V	2.27	1.00
21_L	24_E	2.173	1.00
57_R	107_E	2.157	1.00
126_Q	130_D	2.13	1.00
128_I	131_A	1.96	1.00
115_P	118_V	1.92	1.00
75_I	111_L	1.873	1.00
7_C	23_A	1.847	1.00
64_T	112_G	1.817	1.00
67_G	114_Q	1.794	1.00
61_V	135_V	1.635	0.99
60_I	108_V	1.584	0.99
51_R	104_D	1.564	0.99
14_G	117_I	1.548	0.99
30_P	140_E	1.505	0.99
74_R	114_Q	1.438	0.98
66_M	74_R	1.416	0.98
68_L	72_E	1.415	0.98
59_L	111_L	1.413	0.98
11_S	20_P	1.403	0.98
59_L	146_G	1.402	0.98
66_M	114_Q	1.373	0.97
3_D	148_F	1.349	0.97
113_I	135_V	1.339	0.97
113_I	128_I	1.335	0.97
21_L	123_P	1.333	0.97
25_K	28_A	1.326	0.97
4_V	37_I	1.311	0.96
57_R	146_G	1.283	0.96
25_K	29_A	1.281	0.96
18_A	135_V	1.276	0.96
11_S	16_D	1.264	0.95
126_Q	129_K	1.258	0.95
142_W	146_G	1.232	0.94
111_L	135_V	1.226	0.94
14_G	125_T	1.215	0.94
43_P	93_P	1.206	0.94
75_I	109_I	1.205	0.93
3_D	57_R	1.181	0.93
75_I	142_W	1.173	0.92
73_I	135_V	1.159	0.92
4_V	53_L	1.155	0.91
25_K	136_Y	1.153	0.91
130_D	134_T	1.152	0.91
22_L	132_V	1.151	0.91
17_G	21_L	1.148	0.91
112_G	115_P	1.126	0.90
35_V	53_L	1.121	0.90
69_N	72_E	1.108	0.89
144_G	150_Q	1.107	0.89
133_E	137_Q	1.104	0.89
145_N	149_A	1.095	0.88
11_S	38_D	1.094	0.88
3_D	34_W	1.094	0.88
18_A	22_L	1.072	0.87
64_T	74_R	1.072	0.87
141_G	144_G	1.07	0.87
131_A	134_T	1.069	0.87
2_T	56_T	1.065	0.86
117_I	125_T	1.062	0.86
93_P	96_Y	1.048	0.85
7_C	19_G	1.042	0.85
31_K	34_W	1.027	0.84
6_L	39_G	1.024	0.83
144_G	149_A	1.022	0.83
60_I	94_L	1.015	0.83
133_E	136_Y	1.013	0.82
89_T	93_P	1.01	0.82
59_L	139_L	1.004	0.82

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2e85A	2	1	100	0.101	Contact Map	0.655
1cfzA	6	0.9872	100	0.127	Contact Map	0.683
3pu6A	1	0.9744	100	0.174	Contact Map	0.585
1c8bA	2	0.9231	97.3	0.81	Contact Map	0.648
2b0jA	1	0.9103	50.9	0.909	Contact Map	0.053
2wjaA	2	0.6667	50.3	0.909	Contact Map	0.499
4i8iA	1	0.9679	46.3	0.911	Contact Map	0.297
2wmyA	8	0.6795	45.2	0.912	Contact Map	0.452
3l9wA	2	0.9231	44.3	0.912	Contact Map	0.306
3neaA	1	0.9103	37.3	0.916	Contact Map	0.524

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0661 seconds.