OPENSEQ.org - YGIW - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YGIW - Protein YgiW

UniProt:	P0ADU5	Sequence MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTWVTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEIDVKQIRKVNP	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13025
Length:	130 (129)
Sequences:	231
Seq/Len:	1.79

YGIW
Paralog alert: 0.59 [within 20: 0.01] - ratio of genomes with paralogs
Cluster includes: YDEI YGIW

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
64_R	106_E	3.5	1.00
111_V	120_I	2.347	1.00
66_N	104_T	1.887	0.98
67_I	94_W	1.72	0.96
63_L	85_I	1.676	0.95
103_D	127_K	1.668	0.95
70_R	73_D	1.63	0.94
49_V	52_A	1.623	0.93
72_S	75_L	1.578	0.92
75_L	86_N	1.548	0.91
107_I	120_I	1.545	0.91
57_D	112_D	1.516	0.90
68_V	79_K	1.495	0.89
74_D	90_D	1.487	0.89
69_E	103_D	1.481	0.89
81_A	107_I	1.468	0.88
16_A	82_S	1.449	0.87
76_Y	89_I	1.449	0.87
74_D	111_V	1.403	0.85
69_E	77_V	1.381	0.83
88_D	125_I	1.38	0.83
85_I	107_I	1.37	0.83
48_T	82_S	1.361	0.82
15_S	20_A	1.333	0.80
69_E	119_E	1.328	0.80
88_D	118_V	1.313	0.79
69_E	91_H	1.306	0.78
104_T	128_V	1.273	0.76
61_V	100_T	1.267	0.75
114_D	118_V	1.238	0.73
97_V	103_D	1.233	0.73
79_K	82_S	1.23	0.72
106_E	126_R	1.219	0.71
77_V	84_T	1.219	0.71
96_G	101_P	1.203	0.70
107_I	129_N	1.203	0.70
87_V	110_E	1.202	0.70
46_V	85_I	1.155	0.65
39_F	94_W	1.149	0.65
41_G	114_D	1.131	0.63
50_E	82_S	1.125	0.62
99_V	105_V	1.124	0.62
69_E	88_D	1.122	0.62
62_T	75_L	1.119	0.62
26_F	101_P	1.106	0.60
68_V	88_D	1.104	0.60
101_P	112_D	1.103	0.60
58_D	90_D	1.101	0.60
59_T	124_Q	1.093	0.59
108_Q	126_R	1.09	0.59
108_Q	115_W	1.087	0.58
116_N	119_E	1.086	0.58
26_F	67_I	1.08	0.58
99_V	107_I	1.076	0.57
56_R	118_V	1.07	0.57
82_S	125_I	1.068	0.56
61_V	120_I	1.068	0.56
101_P	113_K	1.061	0.56
4_F	10_V	1.059	0.55
85_I	118_V	1.05	0.54
38_G	41_G	1.046	0.54
97_V	100_T	1.042	0.54
94_W	118_V	1.033	0.53
107_I	125_I	1.032	0.53
87_V	107_I	1.032	0.53
116_N	120_I	1.027	0.52
6_A	10_V	1.023	0.52
52_A	55_L	1.02	0.51
87_V	91_H	1.014	0.51
50_E	128_V	1.013	0.50
41_G	61_V	1.01	0.50
76_Y	90_D	1.007	0.50
37_G	40_Q	1.006	0.50
55_L	59_T	1	0.49

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1nnxA	1	0.8385	100	0.198	Contact Map	0.454
4gnxB	2	0.6923	95.8	0.856	Contact Map	0.503
3nemA	2	0.6769	95.5	0.859	Contact Map	0.423
1wydA	2	0.6769	95.5	0.86	Contact Map	0.441
1x54A	1	0.6769	95.4	0.86	Contact Map	0.426
1c0aA	1	0.6692	95.3	0.861	Contact Map	0.447
2xgtA	2	0.6385	95.3	0.861	Contact Map	0.478
3e0eA	1	0.6231	95.3	0.861	Contact Map	0.405
1n9wA	2	0.6231	95.3	0.861	Contact Map	0.463
2pi2A	4	0.9154	95.2	0.862	Contact Map	0.514

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0195 seconds.