OPENSEQ.org - YFCZ - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YFCZ - UPF0381 protein YfcZ

UniProt:	P0AD33	Sequence MSKCSADETPVCCCMDVGTIMDNSDCTASYSRVFANRAEAEQTLAALTEKARSVESEPCKITPTFTEESDGVRLDIDFTFACEAEMLIFQLGLR	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG14129
Length:	94 (94)
Sequences:	95
Seq/Len:	1.01

YFCZ
Paralog alert: 0.64 [within 20: 0.00] - ratio of genomes with paralogs
Cluster includes: YFCZ YIIS

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
37_R	41_E	3.082	1.00
52_R	55_E	2.346	0.99
73_R	81_A	2.258	0.98
37_R	67_E	1.751	0.89
83_E	87_L	1.728	0.89
64_T	75_D	1.464	0.75
31_S	73_R	1.459	0.74
9_T	13_C	1.449	0.73
64_T	83_E	1.409	0.70
57_E	81_A	1.404	0.70
58_P	61_I	1.361	0.67
36_N	69_S	1.356	0.66
15_M	83_E	1.344	0.65
21_M	86_M	1.339	0.65
41_E	69_S	1.331	0.64
43_T	46_A	1.278	0.59
4_C	14_C	1.277	0.59
37_R	65_F	1.269	0.59
68_E	73_R	1.239	0.56
30_Y	33_V	1.235	0.56
24_S	83_E	1.215	0.54
33_V	70_D	1.188	0.51
49_E	53_S	1.168	0.49
1_M	10_P	1.155	0.48
23_N	93_L	1.153	0.48
21_M	54_V	1.153	0.48
18_G	91_L	1.149	0.48
55_E	90_Q	1.147	0.47
65_F	73_R	1.127	0.45
60_K	64_T	1.119	0.45
4_C	12_C	1.108	0.44
57_E	69_S	1.103	0.43
9_T	14_C	1.096	0.43
25_D	55_E	1.092	0.42
13_C	90_Q	1.086	0.42
31_S	75_D	1.076	0.41
48_T	59_C	1.06	0.39
44_L	78_F	1.058	0.39
4_C	19_T	1.052	0.39
45_A	70_D	1.051	0.39
62_T	75_D	1.049	0.38
28_A	90_Q	1.04	0.38
21_M	24_S	1.026	0.36
30_Y	34_F	1.024	0.36
11_V	14_C	1.024	0.36
6_A	14_C	1.02	0.36
49_E	57_E	1.015	0.35
1_M	11_V	1.015	0.35
10_P	92_G	1.014	0.35
30_Y	53_S	1.003	0.34
11_V	79_T	1.003	0.34
5_S	37_R	1.002	0.34

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2k3iA	1	0.9574	100	0.214	Contact Map	0.258
2khdA	1	0.9681	100	0.321	Contact Map	0.119
2jz5A	1	0.8298	100	0.331	Contact Map	0.233
3lq9A	2	0.7872	5.7	0.948	Contact Map	0.005
1ha8A	1	0.2979	4.1	0.951	Contact Map	0.749
3sqgB	3	0.5106	2.1	0.958	Contact Map	0.209
2o7aA	1	0.5	1.9	0.959	Contact Map	0.465
2d9qB	1	0.3617	1.9	0.959	Contact Map	0.054
2ibfB	2	0.266	1.8	0.96	Contact Map	0.638
3eazA	1	0.7553	1.8	0.96	Contact Map	0.193

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0118 seconds.