OPENSEQ.org - TPX - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

TPX - Thiol peroxidase

UniProt:	P0A862	Sequence MSQTVHFQGNPVTVANSIPQAGSKAQTFTLVAKDLSDVTLGQFAGKRKVLNIFPSIDTGVCAASVRKFNQLATEIDNTVVLCISADLPFAQSRFCGAEGLNNVITLSTFRNAEFLQAYGVAIADGPLKGLAARAVVVIDENDNVIFSQLVDEITTEPDYEAALAVLKA	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12672
Length:	168 (150)
Sequences:	7779
Seq/Len:	51.86

TPX
Paralog alert: 0.86 [within 20: 0.09] - ratio of genomes with paralogs
Cluster includes: AHPC BCP DSBE TPX

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
47_R	140_E	3.897	1.00
29_T	37_D	3.082	1.00
46_K	79_V	3.049	1.00
25_A	118_Y	2.85	1.00
56_I	91_Q	2.776	1.00
32_A	36_S	2.647	1.00
139_D	145_I	2.523	1.00
29_T	39_T	2.502	1.00
139_D	143_N	2.465	1.00
69_N	102_N	2.455	1.00
24_K	143_N	2.314	1.00
72_A	76_D	2.202	1.00
31_V	37_D	2.126	1.00
39_T	42_Q	2.057	1.00
27_T	41_G	2.054	1.00
113_E	117_A	1.997	1.00
71_L	74_E	1.991	1.00
20_Q	23_S	1.985	1.00
27_T	39_T	1.935	1.00
30_L	106_L	1.897	1.00
38_V	43_F	1.576	1.00
44_A	48_K	1.536	1.00
33_K	95_C	1.512	1.00
48_K	142_D	1.506	1.00
48_K	79_V	1.482	1.00
57_D	93_R	1.481	1.00
78_T	166_L	1.479	1.00
73_T	76_D	1.474	1.00
82_C	105_T	1.461	1.00
122_I	132_A	1.453	1.00
160_E	164_A	1.451	1.00
67_K	71_L	1.434	1.00
49_V	137_V	1.427	1.00
30_L	114_F	1.379	0.99
48_K	81_L	1.372	0.99
41_G	44_A	1.366	0.99
115_L	131_A	1.36	0.99
71_L	160_E	1.358	0.99
43_F	81_L	1.333	0.99
43_F	48_K	1.328	0.99
146_F	165_V	1.319	0.99
65_V	100_L	1.306	0.99
72_A	102_N	1.271	0.99
52_I	83_I	1.266	0.99
85_A	115_L	1.255	0.99
93_R	96_G	1.241	0.98
32_A	38_V	1.239	0.98
85_A	112_A	1.235	0.98
92_S	96_G	1.226	0.98
76_D	79_V	1.203	0.98
67_K	70_Q	1.194	0.98
74_E	160_E	1.191	0.98
88_P	92_S	1.179	0.98
120_V	136_V	1.179	0.98
27_T	40_L	1.176	0.98
73_T	102_N	1.155	0.97
71_L	159_Y	1.144	0.97
32_A	106_L	1.134	0.97
25_A	138_I	1.13	0.97
89_F	93_R	1.13	0.97
138_I	144_V	1.129	0.97
48_K	138_I	1.122	0.97
82_C	103_V	1.119	0.96
114_F	118_Y	1.111	0.96
31_V	88_P	1.107	0.96
49_V	135_V	1.097	0.96
47_R	137_V	1.096	0.96
62_A	98_E	1.096	0.96
87_L	90_A	1.086	0.96
66_R	70_Q	1.065	0.95
50_L	138_I	1.065	0.95
51_N	65_V	1.061	0.95
32_A	104_I	1.055	0.95
112_A	121_A	1.045	0.94
25_A	144_V	1.041	0.94
74_E	167_K	1.037	0.94
51_N	64_S	1.029	0.94
69_N	103_V	1.013	0.93
19_P	144_V	1.011	0.93
64_S	135_V	1.003	0.93
58_T	133_R	1.002	0.92

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
4je1A	2	0.9881	100	0.23	Contact Map	0.588
1xvqA	1	0.9702	100	0.234	Contact Map	0.604
1q98A	2	0.9821	100	0.238	Contact Map	0.709
2yzhA	4	0.9881	100	0.243	Contact Map	0.743
3zrdA	2	0.994	100	0.247	Contact Map	0.697
2v2gA	4	0.881	100	0.252	Contact Map	0.75
3p7xA	4	0.9702	100	0.257	Contact Map	0.765
1prxA	2	0.8929	100	0.265	Contact Map	0.688
1xvwA	2	0.9048	100	0.265	Contact Map	0.788
1psqA	2	0.9583	100	0.266	Contact Map	0.734

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0251 seconds.