OPENSEQ.org - TATE - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

TATE - Sec-independent protein translocase protein TatE

UniProt:	P0A843	Sequence MGEISITKLLVVAALVVLLFGTKKLRTLGGDLGAAIKGFKKAMNDDDAAAKKGADVDLQAEKLSHKE	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG11305
Length:	67 (66)
Sequences:	206
Seq/Len:	3.12

TATE
Paralog alert: 0.66 [within 20: 0.00] - ratio of genomes with paralogs
Cluster includes: TATA TATE

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
4_I	9_L	2.059	1.00
53_G	56_V	1.738	0.99
22_T	29_G	1.715	0.99
8_K	11_V	1.611	0.98
5_S	10_L	1.558	0.97
4_I	8_K	1.55	0.97
13_A	35_A	1.546	0.97
2_G	23_K	1.534	0.97
41_K	46_D	1.418	0.94
29_G	35_A	1.411	0.94
24_K	42_A	1.385	0.93
9_L	42_A	1.341	0.91
3_E	9_L	1.336	0.91
26_R	29_G	1.315	0.90
28_L	43_M	1.303	0.90
29_G	33_G	1.299	0.90
37_K	40_K	1.238	0.86
16_V	36_I	1.227	0.86
1_M	56_V	1.215	0.85
34_A	45_D	1.212	0.85
44_N	52_K	1.2	0.84
47_D	57_D	1.172	0.82
47_D	50_A	1.153	0.81
22_T	35_A	1.15	0.80
57_D	60_A	1.102	0.76
26_R	35_A	1.091	0.75
2_G	6_I	1.063	0.73
10_L	17_V	1.052	0.71
13_A	26_R	1.049	0.71
29_G	38_G	1.048	0.71
18_L	42_A	1.047	0.71
14_A	17_V	1.039	0.70
22_T	25_L	1.034	0.70
30_G	35_A	1.031	0.69
2_G	13_A	1.013	0.67
23_K	36_I	1.011	0.67
8_K	42_A	1.01	0.67
2_G	7_T	1.007	0.67
26_R	34_A	1.002	0.66

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2l16A	1	1	99.5	0.416	Contact Map	0.134
2lzrA	1	0.8209	99.3	0.46	Contact Map	0.112
4fu6A	1	1	7.7	0.903	Contact Map	0.045
3j0cA	4	0.403	7.7	0.903	Contact Map	0.122
3ar4A	1	0.5373	7.2	0.904	Contact Map	0.363
1skhA	1	0.4478	6.8	0.906	Contact Map	0.084
3j0fE	4	0.3582	4.8	0.912	Contact Map	0.003
3g6mA	1	0.6567	4.2	0.915	Contact Map	0.018
3qhoA	3	0.3731	4.2	0.915	Contact Map
3o6cA	1	0.4776	4.2	0.915	Contact Map	0.206

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.