OPENSEQ.org - MQSA - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

MQSA - Antitoxin MqsA

UniProt:	Q46864	Sequence MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKKLSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13022
Length:	131 (131)
Sequences:	201
Seq/Len:	1.53

MQSA
Paralog alert: 0.05 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
3_C	6_C	2.557	1.00
6_C	40_C	2.5	1.00
109_P	114_I	2.402	1.00
88_A	99_F	2.198	0.99
37_C	40_C	2.162	0.99
94_G	98_A	2.085	0.99
78_R	103_E	2.053	0.98
3_C	40_C	1.962	0.98
110_H	113_T	1.794	0.96
86_K	91_I	1.785	0.95
83_L	87_E	1.661	0.93
17_D	28_V	1.594	0.90
3_C	37_C	1.558	0.89
40_C	101_R	1.553	0.89
25_R	64_V	1.536	0.88
6_C	101_R	1.532	0.88
15_I	29_L	1.531	0.88
22_F	64_V	1.448	0.84
6_C	37_C	1.419	0.82
84_T	87_E	1.378	0.80
36_Y	43_S	1.376	0.79
83_L	127_L	1.373	0.79
71_P	78_R	1.354	0.78
88_A	94_G	1.349	0.77
69_V	109_P	1.339	0.77
107_A	118_R	1.33	0.76
43_S	53_F	1.32	0.75
101_R	113_T	1.282	0.72
95_G	124_P	1.263	0.71
61_R	67_E	1.255	0.70
63_S	82_S	1.245	0.69
51_D	75_V	1.245	0.69
17_D	30_K	1.214	0.66
74_I	117_L	1.199	0.65
36_Y	46_N	1.197	0.65
123_H	129_E	1.196	0.65
19_P	24_G	1.179	0.63
91_I	119_V	1.151	0.60
71_P	103_E	1.151	0.60
123_H	126_L	1.114	0.56
31_G	67_E	1.111	0.56
60_F	64_V	1.107	0.56
99_F	124_P	1.107	0.56
69_V	82_S	1.103	0.55
114_I	118_R	1.094	0.54
37_C	101_R	1.083	0.53
41_E	82_S	1.079	0.53
78_R	85_Q	1.064	0.51
49_E	61_R	1.053	0.50
4_P	7_H	1.051	0.50
94_G	117_L	1.042	0.49
1_M	10_E	1.039	0.49
21_T	90_E	1.035	0.48
83_L	103_E	1.021	0.47
101_R	110_H	1.02	0.47
56_Q	60_F	1.017	0.46
58_K	61_R	1.017	0.46
20_Y	29_L	1.012	0.46
117_L	120_L	1.006	0.45

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
3o9xA	2	1	99.9	0.397	Contact Map	0.591
3ga8A	1	0.5725	99.6	0.617	Contact Map	0.746
3fmyA	1	0.5573	98.8	0.739	Contact Map	0.585
1s4kA	2	0.4962	98.7	0.748	Contact Map	0.383
2ppxA	1	0.6336	98.4	0.768	Contact Map	0.61
2auwA	2	0.9466	98.4	0.772	Contact Map	0.447
2kpjA	1	0.542	97.9	0.801	Contact Map	0.434
2o38A	2	0.7481	97.8	0.801	Contact Map	0.415
1y9qA	1	0.5573	97.8	0.805	Contact Map	0.505
1r69A	1	0.4809	97.8	0.805	Contact Map	0.475

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 1.1486 seconds.