OPENSEQ.org - PBL - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

PBL - Putative peptidoglycan-binding-like protein

UniProt:	Q46790	Sequence MRSPKVKFLTIFTFCIFITKMSFASNSCSNEAGTMFRIEPNLIKAIALVESNLKKDSIGKNRDKNNNIKSLDYWLMQINQMHIPLLKKRGIIKDERDLLDNPCLNIKIGTEILYNHFSRCGVTWQCLGTYNAGFAMDNQKKRQQYAPKYILYIPGLMN	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13040
Length:	158 (148)
Sequences:	216
Seq/Len:	1.46

PBL
Paralog alert: 0.48 [within 20: 0.01] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
43_I	110_T	2.468	1.00
49_V	148_K	2.111	0.99
116_H	129_T	2.024	0.98
46_I	113_L	1.915	0.97
76_M	109_G	1.853	0.96
42_L	131_N	1.832	0.96
73_Y	83_I	1.72	0.94
72_D	79_N	1.642	0.91
27_S	106_I	1.602	0.90
43_I	57_S	1.566	0.89
28_C	103_C	1.562	0.88
143_Q	151_L	1.507	0.86
49_V	151_L	1.473	0.84
33_G	40_P	1.458	0.83
75_L	109_G	1.453	0.83
82_H	116_H	1.427	0.82
116_H	126_C	1.421	0.81
35_M	107_K	1.401	0.80
18_I	24_A	1.396	0.80
29_S	105_N	1.388	0.79
126_C	129_T	1.344	0.76
47_A	76_M	1.33	0.75
62_R	99_L	1.329	0.75
45_A	52_N	1.326	0.74
54_K	110_T	1.29	0.72
39_E	152_Y	1.278	0.71
54_K	57_S	1.278	0.71
48_L	53_L	1.265	0.69
86_L	90_G	1.243	0.67
12_F	15_C	1.225	0.66
9_L	14_F	1.215	0.65
109_G	122_V	1.21	0.64
28_C	32_A	1.208	0.64
114_Y	118_S	1.206	0.64
12_F	18_I	1.202	0.64
10_T	13_T	1.182	0.62
42_L	109_G	1.176	0.61
78_I	129_T	1.172	0.61
32_A	78_I	1.171	0.61
35_M	78_I	1.163	0.60
10_T	17_F	1.163	0.60
99_L	106_I	1.159	0.59
142_R	145_Y	1.145	0.58
33_G	38_I	1.144	0.58
105_N	116_H	1.144	0.58
97_D	101_N	1.139	0.58
142_R	146_A	1.134	0.57
31_E	106_I	1.123	0.56
13_T	17_F	1.108	0.54
42_L	132_A	1.107	0.54
116_H	127_L	1.104	0.54
133_G	152_Y	1.098	0.53
78_I	83_I	1.095	0.53
102_P	125_Q	1.093	0.53
47_A	75_L	1.083	0.52
57_S	110_T	1.08	0.52
105_N	134_F	1.076	0.51
61_N	72_D	1.075	0.51
116_H	120_C	1.072	0.51
53_L	62_R	1.071	0.51
74_W	105_N	1.063	0.50
12_F	23_F	1.06	0.49
63_D	96_R	1.052	0.49
48_L	52_N	1.051	0.49
12_F	17_F	1.05	0.48
11_I	15_C	1.05	0.48
82_H	108_I	1.05	0.48
44_K	107_K	1.047	0.48
125_Q	143_Q	1.044	0.48
64_K	72_D	1.04	0.47
86_L	91_I	1.039	0.47
8_F	12_F	1.03	0.46
49_V	78_I	1.028	0.46
38_I	87_K	1.028	0.46
8_F	16_I	1.028	0.46
120_C	126_C	1.023	0.46
13_T	18_I	1.017	0.45
9_L	20_K	1.016	0.45
111_E	118_S	1.016	0.45
10_T	16_I	1.014	0.45
27_S	44_K	1.008	0.44
59_G	138_N	1.005	0.44
109_G	131_N	1.001	0.43

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1lsgA	1	0.7595	99.9	0.584	Contact Map	0.187
3b72A	1	0.8038	99.9	0.631	Contact Map	0.206
4g9sA	1	0.8987	99.9	0.636	Contact Map	0.377
1gbsA	1	0.8987	99.9	0.637	Contact Map	0.41
1qsaA	1	0.9367	99.9	0.637	Contact Map	0.424
3w6bA	4	0.9177	99.9	0.638	Contact Map	0.435
3gxrA	4	0.8987	99.8	0.64	Contact Map	0.434
3t21A	2	0.9051	99.8	0.655	Contact Map	0.404
1hmlA	1	0.7848	99.8	0.674	Contact Map	0.288
2vb1A	1	0.7089	99.8	0.679	Contact Map	0.278

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.8063 seconds.