OPENSEQ.org - SIRB2 - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

SIRB2 - Protein sirB2

UniProt:	Q46755	Sequence MTSFSTLLSVHLISIALSVGLLTLRFWLRYQKHPQAFARWTRIVPPVVDTLLLLSGIALMAKAHILPFSGQAQWLTEKLFGVIIYIVLGFIALDYRRMHSQQARIIAFPLALVVLYIIIKLATTKVPLLG	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG14293
Length:	130 (123)
Sequences:	230
Seq/Len:	1.87

SIRB2
Paralog alert: 0.02 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
28_L	41_T	3.53	1.00
17_L	48_V	2.569	1.00
4_F	8_L	2.247	1.00
14_S	51_L	2.237	1.00
12_L	15_I	2.17	0.99
7_L	58_A	2.153	0.99
7_L	62_K	1.966	0.99
66_L	76_T	1.877	0.98
43_I	50_T	1.733	0.96
88_L	107_A	1.627	0.94
29_R	98_M	1.598	0.93
87_V	91_I	1.591	0.93
81_G	117_I	1.411	0.86
22_L	41_T	1.403	0.86
57_I	79_L	1.393	0.85
88_L	110_L	1.378	0.84
58_A	62_K	1.367	0.84
122_A	125_K	1.358	0.83
21_L	41_T	1.342	0.82
39_R	43_I	1.327	0.81
65_I	76_T	1.32	0.80
6_T	9_S	1.309	0.80
91_I	107_A	1.302	0.79
27_W	114_V	1.297	0.79
77_E	82_V	1.275	0.77
77_E	121_L	1.261	0.76
25_R	52_L	1.248	0.75
88_L	114_V	1.24	0.74
22_L	115_L	1.228	0.73
84_I	114_V	1.22	0.73
42_R	99_H	1.211	0.72
12_L	16_A	1.195	0.70
68_F	76_T	1.184	0.69
28_L	39_R	1.168	0.68
70_G	96_R	1.157	0.67
42_R	97_R	1.156	0.67
60_M	65_I	1.155	0.67
49_D	52_L	1.139	0.65
86_I	89_G	1.133	0.64
75_L	109_P	1.13	0.64
110_L	114_V	1.124	0.64
52_L	86_I	1.12	0.63
117_I	121_L	1.117	0.63
22_L	28_L	1.101	0.61
115_L	121_L	1.092	0.60
15_I	26_F	1.091	0.60
51_L	118_I	1.091	0.60
26_F	108_F	1.082	0.59
14_S	48_V	1.079	0.59
42_R	45_P	1.069	0.58
8_L	67_P	1.067	0.58
39_R	96_R	1.066	0.57
33_H	36_A	1.062	0.57
81_G	118_I	1.058	0.57
28_L	33_H	1.057	0.57
8_L	113_V	1.041	0.55
89_G	124_T	1.041	0.55
93_L	124_T	1.041	0.55
10_V	23_T	1.04	0.55
21_L	35_Q	1.031	0.54
98_M	101_Q	1.021	0.53
104_R	111_A	1.013	0.52
56_G	100_S	1.004	0.51

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results:

PDB	Chains	Cov	P(%)	HHΔ		Acc
1iq5B	1	0.2077	8.5	0.938	Contact Map	0.648
1ckkB	1	0.2	6.1	0.942	Contact Map	0.207
1jb0A	1	0.6231	2	0.955	Contact Map	0.11
1q16C	1	0.9308	1.3	0.959	Contact Map	0.111
3giaA	1	0.9385	1.3	0.96	Contact Map	0.071
3kg2A	4	0.3385	1.2	0.96	Contact Map	0.211
4hg6A	1	0.7	0.9	0.963	Contact Map	0.148
1wazA	1	0.3462	0.9	0.964	Contact Map	0.522
3nvwA	2	0.3	0.8	0.965	Contact Map	0.762
1vdaA	1	0.0846	0.7	0.967	Contact Map	0

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.2155 seconds.