OPENSEQ.org - EXOD - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

EXOD - Putative uncharacterized protein ExoD

UniProt:	P75717	Sequence MKFRLGGFEAIKSAYMAQVQYSMWVTRKDAWYFANYDPRMKREGLHYVVIERNEKYMASFDEMVPEFIEKMDEALAEIGFVFGEQWR	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12349
Length:	87 (86)
Sequences:	100
Seq/Len:	1.16

EXOD
Paralog alert: 0.40 [within 20: 0.01] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
20_Q	52_R	2.216	0.98
45_L	49_V	2.015	0.97
19_V	23_M	1.818	0.93
46_H	49_V	1.756	0.92
72_D	76_A	1.501	0.81
15_Y	68_I	1.437	0.76
16_M	62_E	1.414	0.75
81_V	84_E	1.412	0.75
28_K	57_M	1.403	0.74
22_S	25_V	1.399	0.74
41_K	47_Y	1.385	0.73
20_Q	53_N	1.361	0.71
32_Y	37_D	1.358	0.70
82_F	86_W	1.351	0.70
52_R	57_M	1.307	0.66
22_S	31_W	1.301	0.66
5_L	16_M	1.288	0.65
40_M	71_M	1.252	0.61
82_F	85_Q	1.227	0.59
43_E	48_V	1.222	0.59
24_W	57_M	1.217	0.58
17_A	20_Q	1.215	0.58
23_M	26_T	1.212	0.58
45_L	48_V	1.208	0.57
19_V	31_W	1.187	0.55
37_D	50_I	1.184	0.55
30_A	84_E	1.174	0.54
21_Y	58_A	1.171	0.54
6_G	77_E	1.167	0.53
11_I	61_D	1.153	0.52
4_R	16_M	1.144	0.51
20_Q	24_W	1.135	0.50
7_G	33_F	1.132	0.50
73_E	76_A	1.13	0.50
10_A	29_D	1.125	0.49
10_A	77_E	1.116	0.48
79_G	82_F	1.115	0.48
41_K	44_G	1.109	0.48
27_R	51_E	1.094	0.46
4_R	17_A	1.075	0.44
79_G	86_W	1.07	0.44
80_F	86_W	1.059	0.43
51_E	54_E	1.059	0.43
25_V	71_M	1.045	0.42
15_Y	33_F	1.032	0.40
1_M	8_F	1.005	0.38
81_V	85_Q	1.002	0.38

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
3sm4A	3	1	99.8	0.397	Contact Map	0.392
3syyA	1	0.977	99.7	0.5	Contact Map	0.384
3k93A	1	0.8851	99.5	0.541	Contact Map	0.384
2w45A	2	0.954	95.8	0.813	Contact Map	0.106
1wteA	2	1	13.2	0.92	Contact Map	0.21
3fx7A	2	0.4598	9.3	0.925	Contact Map	0.69
2wpqA	3	0.3563	7.9	0.928	Contact Map	0.643
3c3fA	4	0.3563	7.5	0.928	Contact Map	0.421
3c3gA	1	0.3448	7.2	0.929	Contact Map	0.459
2oxjA	3	0.3563	7.2	0.929	Contact Map	0.222

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.4998 seconds.