OPENSEQ.org - YFCL - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YFCL - Uncharacterized protein YfcL

UniProt:	P64540	Sequence MIAEFESRILALIDGMVDHASDDELFASGYLRGHLTLAIAELESGDDHSAQAVHTTVSQSLEKAIGAGELSPRDQALVTDMWENLFQQASQQ	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG14115
Length:	92 (90)
Sequences:	111
Seq/Len:	1.23

YFCL
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
58_S	62_E	2.027	0.97
51_Q	55_T	1.822	0.94
6_E	13_I	1.638	0.89
14_D	37_L	1.51	0.82
36_T	39_I	1.468	0.80
54_H	90_S	1.456	0.79
40_A	43_E	1.385	0.74
53_V	62_E	1.38	0.74
15_G	88_Q	1.349	0.71
7_S	66_G	1.346	0.71
42_L	45_G	1.321	0.69
32_R	37_L	1.284	0.66
76_A	79_T	1.282	0.66
63_K	83_E	1.277	0.65
49_S	62_E	1.271	0.65
83_E	86_F	1.254	0.63
42_L	90_S	1.245	0.62
50_A	56_T	1.237	0.62
28_S	73_R	1.223	0.60
20_A	57_V	1.215	0.60
20_A	28_S	1.213	0.59
1_M	13_I	1.213	0.59
1_M	21_S	1.207	0.59
56_T	66_G	1.206	0.59
7_S	42_L	1.18	0.56
15_G	48_H	1.177	0.56
22_D	47_D	1.175	0.56
1_M	85_L	1.166	0.55
79_T	86_F	1.166	0.55
5_F	61_L	1.142	0.53
19_H	36_T	1.14	0.52
18_D	45_G	1.135	0.52
14_D	32_R	1.133	0.52
38_A	57_V	1.124	0.51
2_I	12_L	1.117	0.50
17_V	41_E	1.103	0.49
80_D	87_Q	1.099	0.48
83_E	87_Q	1.088	0.47
78_V	82_W	1.075	0.46
57_V	77_L	1.071	0.46
45_G	66_G	1.07	0.46
19_H	52_A	1.067	0.45
38_A	68_G	1.06	0.45
55_T	83_E	1.058	0.44
20_A	41_E	1.055	0.44
37_L	60_S	1.055	0.44
73_R	76_A	1.052	0.44
15_G	83_E	1.049	0.44
28_S	45_G	1.046	0.43
83_E	90_S	1.039	0.43
2_I	71_S	1.036	0.42
66_G	73_R	1.018	0.41
84_N	90_S	1.003	0.39

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results:

PDB	Chains	Cov	P(%)	HHΔ		Acc
4hrrB	4	0.3804	29.6	0.915	Contact Map	0.313
4hrrA	4	0.3587	23.4	0.919	Contact Map	0.361
2genA	1	1	14.9	0.926	Contact Map	0.174
2jj7A	2	0.9783	14.7	0.926	Contact Map	0.259
3mnlA	2	0.9457	11	0.93	Contact Map	0.124
3bqzB	2	0.9783	10.8	0.93	Contact Map	0.204
2dc3A	2	0.4783	9.9	0.932	Contact Map	0.449
4gfkA	2	0.7174	8.9	0.933	Contact Map	0.128
3s5rA	2	0.9891	8.6	0.934	Contact Map	0.124
3g46A	2	0.3478	8.5	0.934	Contact Map	0.298

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.2352 seconds.