OPENSEQ.org - YNBE - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YNBE - Uncharacterized protein YnbE

UniProt:	P64448	Sequence MKILLAALTSSFMLVGCTPRIEVAAPKEPITINMNVKIEHEIIIKADKDVEELLETRSDLF	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG14298
Length:	61 (60)
Sequences:	138
Seq/Len:	2.30

YNBE
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
34_M	54_L	1.889	0.99
39_E	44_I	1.737	0.98
51_E	55_E	1.727	0.97
31_T	49_D	1.603	0.96
6_A	9_T	1.541	0.94
16_G	47_D	1.476	0.92
25_A	34_M	1.391	0.89
28_E	31_T	1.367	0.88
6_A	10_S	1.319	0.85
25_A	53_L	1.316	0.85
21_I	43_I	1.311	0.85
27_K	31_T	1.268	0.82
50_V	59_D	1.23	0.79
45_K	56_T	1.219	0.78
21_I	27_K	1.177	0.75
16_G	43_I	1.175	0.75
40_H	58_S	1.174	0.74
55_E	58_S	1.146	0.72
42_I	58_S	1.143	0.72
21_I	28_E	1.127	0.70
37_K	41_E	1.127	0.70
37_K	46_A	1.113	0.69
10_S	23_V	1.088	0.66
9_T	12_F	1.082	0.66
22_E	47_D	1.076	0.65
19_P	26_P	1.074	0.65
8_L	11_S	1.06	0.63
27_K	48_K	1.055	0.63
46_A	61_F	1.051	0.62
40_H	48_K	1.038	0.61
39_E	43_I	1.024	0.59
22_E	36_V	1.018	0.59

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results:

PDB	Chains	Cov	P(%)	HHΔ		Acc
4jg9A	2	1	59.7	0.85	Contact Map	0.018
3tlkA	3	0.8689	58.9	0.851	Contact Map	0.003
3ombA	1	1	49.2	0.859	Contact Map	0.051
2w7yA	2	1	48	0.86	Contact Map	0
3zbiC	14	0.7541	41.1	0.866	Contact Map	0
4nf0A	8	0.9672	25.8	0.879	Contact Map	0.093
4edpA	2	1	21.7	0.883	Contact Map	0.107
4jwoA	1	0.9836	21.7	0.883	Contact Map	0.017
4ng7A	1	0.918	20.6	0.885	Contact Map	0
4n6kA	1	0.918	19.5	0.886	Contact Map	0.077

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.8672 seconds.