OPENSEQ.org - EUTS - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

EUTS - Ethanolamine utilization protein EutS

UniProt:	P63746	Sequence MDKERIIQEFVPGKQVTLAHLIAHPGEELAKKIGVPDAGAIGIMTLTPGETAMIAGDLALKAADVHIGFLDRFSGALVIYGSVGAVEEALSQTVSGLGRLLNYTLCEMTKS	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG14192
Length:	111 (110)
Sequences:	149
Seq/Len:	1.35

EUTS
Paralog alert: 0.32 [within 20: 0.01] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
46_L	51_T	2.501	1.00
16_V	97_L	2.445	1.00
41_I	80_Y	2.164	0.99
30_A	33_I	1.878	0.96
21_L	90_L	1.815	0.95
63_A	70_L	1.628	0.90
51_T	103_Y	1.603	0.89
87_E	110_K	1.535	0.86
10_F	47_T	1.524	0.85
21_L	107_E	1.518	0.85
7_I	23_A	1.499	0.84
18_L	47_T	1.49	0.83
82_S	85_A	1.458	0.82
64_D	89_A	1.428	0.80
8_Q	32_K	1.411	0.79
91_S	107_E	1.35	0.74
33_I	49_G	1.348	0.74
60_L	78_V	1.313	0.71
89_A	108_M	1.3	0.70
68_G	89_A	1.281	0.68
38_A	103_Y	1.258	0.66
56_G	106_C	1.252	0.66
30_A	49_G	1.249	0.66
51_T	78_V	1.239	0.65
92_Q	108_M	1.23	0.64
17_T	54_I	1.217	0.63
76_A	106_C	1.213	0.62
18_L	60_L	1.21	0.62
31_K	35_V	1.201	0.61
29_L	33_I	1.198	0.61
70_L	103_Y	1.189	0.60
19_A	103_Y	1.185	0.60
77_L	90_L	1.149	0.56
8_Q	60_L	1.143	0.56
3_K	47_T	1.138	0.55
82_S	110_K	1.126	0.54
62_A	66_H	1.125	0.54
74_S	94_V	1.114	0.53
51_T	105_L	1.088	0.50
27_E	67_I	1.085	0.50
55_A	59_A	1.078	0.49
49_G	76_A	1.077	0.49
9_E	25_P	1.074	0.49
44_M	90_L	1.071	0.48
6_I	10_F	1.07	0.48
93_T	101_L	1.061	0.47
74_S	88_E	1.058	0.47
96_G	100_L	1.051	0.46
52_A	84_G	1.049	0.46
80_Y	106_C	1.037	0.45
33_I	80_Y	1.03	0.44
4_E	90_L	1.02	0.43
21_L	63_A	1.014	0.43
64_D	85_A	1.014	0.43
35_V	68_G	1.012	0.42
97_L	111_S	1.009	0.42

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
4axiA	2	1	100	0.414	Contact Map	0.306
3i96A	3	1	100	0.42	Contact Map	0.283
3cgiA	4	1	100	0.44	Contact Map	0.293
4fayA	3	0.991	100	0.496	Contact Map	0.175
3io0A	1	0.973	99.9	0.543	Contact Map	0.169
3gfhA	2	0.955	99.8	0.621	Contact Map	0.288
4fdzA	3	0.9459	99.8	0.626	Contact Map	0.296
3u27C	6	0.973	99.8	0.631	Contact Map	0.318
3nwgA	1	0.991	99.7	0.687	Contact Map	0.23
3n79A	1	0.991	99.6	0.69	Contact Map	0.219

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 1.0438 seconds.