OPENSEQ.org - YEIW - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YEIW - UPF0153 protein YeiW

UniProt:	P0AFT8	Sequence MECRPGCGACCTAPSISSPIPGMPDGKPANTPCIQLDEQQRCKIFTSPLRPKVCAGLQASAEMCGNSRQQAMTWLIDLEMLTAP	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG14375
Length:	84 (84)
Sequences:	209
Seq/Len:	2.49

YEIW
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
17_S	53_V	3.041	1.00
32_P	40_Q	2.909	1.00
12_T	72_M	2.824	1.00
57_L	63_M	2.815	1.00
20_I	35_Q	2.535	1.00
37_D	43_K	2.466	1.00
28_P	31_T	2.267	1.00
23_M	34_I	1.921	0.99
57_L	74_W	1.851	0.99
35_Q	43_K	1.829	0.99
2_E	5_P	1.515	0.94
8_G	40_Q	1.511	0.94
53_V	56_G	1.459	0.93
30_N	49_L	1.433	0.92
32_P	38_E	1.427	0.92
32_P	41_R	1.414	0.91
63_M	74_W	1.378	0.90
73_T	76_I	1.351	0.88
77_D	81_L	1.347	0.88
31_T	47_S	1.274	0.84
41_R	84_P	1.272	0.84
53_V	74_W	1.253	0.83
67_S	72_M	1.209	0.79
37_D	41_R	1.19	0.78
67_S	70_Q	1.188	0.78
61_A	81_L	1.173	0.77
30_N	47_S	1.161	0.75
72_M	76_I	1.16	0.75
6_G	58_Q	1.157	0.75
37_D	55_A	1.137	0.73
20_I	34_I	1.081	0.68
35_Q	46_T	1.08	0.68
31_T	49_L	1.074	0.67
41_R	57_L	1.071	0.67
6_G	30_N	1.063	0.66
20_I	23_M	1.05	0.65
66_N	70_Q	1.014	0.61
30_N	65_G	1.009	0.60
57_L	75_L	1.005	0.60
8_G	44_I	1.001	0.59

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results:

PDB	Chains	Cov	P(%)	HHΔ		Acc
4ednK	7	0.2143	4.3	0.951	Contact Map	0.346
2f2cA	1	0.7738	3.5	0.953	Contact Map	0.117
3r4iA	6	0.6071	2.5	0.957	Contact Map	0.245
3qp1A	1	0.381	2.5	0.957	Contact Map	0.196
2kuiA	1	0.4167	2.4	0.957	Contact Map	0.706
1eyvA	2	0.3571	2.4	0.957	Contact Map	0.841
3uwsA	2	0.4405	2.3	0.958	Contact Map	0.123
3qw4B	2	0.5714	2.2	0.958	Contact Map	0.308
1ijxA	6	0.3929	1.9	0.96	Contact Map	0.102
1neyA	2	0.381	1.8	0.96	Contact Map	0.505

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 1.5387 seconds.