OPENSEQ.org - PSPB - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

PSPB - Phage shock protein B

UniProt:	P0AFM9	Sequence MSALFLAIPLTIFVLFVLPIWLWLHYSNRSGRSELSQSEQQRLAQLADEAKRMRERIQALESILDAEHPNWRDR	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG10777
Length:	74 (74)
Sequences:	126
Seq/Len:	1.70

PSPB
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
12_I	20_I	2.269	1.00
12_I	22_L	2.186	0.99
7_A	10_L	1.756	0.96
11_T	37_Q	1.591	0.92
8_I	11_T	1.569	0.91
9_P	17_V	1.527	0.90
34_E	74_R	1.433	0.85
35_L	43_L	1.415	0.84
15_L	29_R	1.413	0.84
4_L	12_I	1.379	0.82
41_Q	70_N	1.352	0.80
4_L	7_A	1.335	0.79
29_R	32_R	1.33	0.79
11_T	59_A	1.27	0.74
43_L	69_P	1.238	0.72
66_A	70_N	1.222	0.70
46_L	67_E	1.212	0.69
13_F	18_L	1.202	0.68
39_E	42_R	1.195	0.68
52_R	68_H	1.172	0.65
2_S	7_A	1.168	0.65
19_P	65_D	1.161	0.64
53_M	62_S	1.158	0.64
5_F	66_A	1.138	0.62
51_K	66_A	1.138	0.62
46_L	50_A	1.136	0.62
7_A	47_A	1.124	0.61
12_I	24_L	1.114	0.60
60_L	64_L	1.107	0.59
23_W	70_N	1.105	0.59
39_E	73_D	1.091	0.57
57_I	68_H	1.054	0.53
19_P	60_L	1.05	0.53
13_F	26_Y	1.049	0.53
29_R	68_H	1.047	0.53
13_F	21_W	1.041	0.52
13_F	17_V	1.028	0.51
23_W	68_H	1.028	0.51
36_S	73_D	1.02	0.50
2_S	36_S	1.014	0.49
10_L	16_F	1.01	0.49
9_P	28_N	1.007	0.48
3_A	6_L	1.006	0.48
25_H	50_A	1.003	0.48

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results:

PDB	Chains	Cov	P(%)	HHΔ		Acc
3pjsK	4	0.9054	43.7	0.895	Contact Map	0.239
3rvyA	2	0.9459	37.9	0.898	Contact Map	0.143
4bgnA	2	1	33.5	0.901	Contact Map	0.189
1zbdB	1	0.5946	25	0.907	Contact Map	0.177
3effK	4	0.9324	22.2	0.909	Contact Map	0.225
3zjzA	4	0.9595	19.7	0.912	Contact Map	0.197
3layA	10	0.973	18.2	0.913	Contact Map	0.201
4ltoA	4	0.8919	17	0.914	Contact Map	0.298
3aqpA	2	0.5541	15.2	0.916	Contact Map	0.075
2ykoA	3	0.4324	11.9	0.92	Contact Map	0.239

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.9436 seconds.