OPENSEQ.org - LPTA - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

LPTA - Lipopolysaccharide export system protein LptA

UniProt:	P0ADV1	Sequence MKFKTNKLSLNLVLASSLLAASIPAFAVTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPSQLQDKNNKGQTPAQKKGN	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12618
Length:	185 (161)
Sequences:	391
Seq/Len:	2.43

LPTA
Paralog alert: 0.01 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
93_A	112_M	3.164	1.00
144_L	147_E	2.748	1.00
110_S	126_N	2.623	1.00
60_V	72_V	2.568	1.00
31_D	64_T	2.327	1.00
53_T	73_V	1.94	0.99
69_A	88_G	1.878	0.99
43_Q	54_F	1.856	0.99
95_F	107_G	1.805	0.98
41_D	57_N	1.798	0.98
61_T	66_K	1.788	0.98
30_G	64_T	1.738	0.98
13_V	17_S	1.736	0.98
93_A	109_A	1.73	0.98
28_V	64_T	1.694	0.97
65_I	95_F	1.601	0.96
73_V	89_Y	1.568	0.95
106_E	130_Q	1.545	0.95
31_D	97_Q	1.455	0.92
120_F	144_L	1.444	0.92
131_Q	134_S	1.443	0.92
108_H	128_Y	1.443	0.92
43_Q	152_A	1.41	0.91
124_T	140_K	1.395	0.90
65_I	97_Q	1.394	0.90
43_Q	162_T	1.379	0.89
64_T	97_Q	1.368	0.89
54_F	152_A	1.351	0.88
36_I	62_Q	1.348	0.88
119_D	146_K	1.327	0.87
41_D	159_R	1.323	0.86
42_Q	55_T	1.323	0.86
67_I	141_I	1.322	0.86
110_S	125_G	1.314	0.86
14_L	17_S	1.312	0.86
92_P	110_S	1.305	0.85
87_D	93_A	1.3	0.85
115_E	118_K	1.264	0.83
50_N	162_T	1.247	0.82
91_K	110_S	1.229	0.80
69_A	72_V	1.223	0.80
115_E	122_V	1.223	0.80
43_Q	50_N	1.221	0.80
148_Q	163_V	1.214	0.79
87_D	113_H	1.194	0.78
64_T	98_M	1.189	0.77
63_G	166_P	1.186	0.77
16_S	20_A	1.172	0.76
45_L	62_Q	1.172	0.76
50_N	54_F	1.166	0.75
28_V	31_D	1.15	0.74
31_D	34_Q	1.147	0.74
14_L	21_A	1.145	0.73
27_A	31_D	1.127	0.72
39_E	57_N	1.12	0.71
34_Q	97_Q	1.107	0.70
40_S	52_V	1.101	0.69
55_T	71_K	1.1	0.69
29_T	100_D	1.098	0.69
13_V	16_S	1.094	0.68
131_Q	150_M	1.091	0.68
68_N	94_T	1.089	0.68
20_A	23_I	1.085	0.67
123_L	127_A	1.08	0.67
105_V	127_A	1.072	0.66
31_D	62_Q	1.068	0.66
73_V	133_D	1.068	0.66
46_D	49_G	1.068	0.66
20_A	80_E	1.068	0.66
36_I	54_F	1.062	0.65
54_F	74_V	1.05	0.64
56_G	165_V	1.047	0.63
109_A	123_L	1.046	0.63
37_H	61_T	1.045	0.63
63_G	143_Y	1.036	0.62
127_A	141_I	1.02	0.60
86_I	129_L	1.01	0.59
113_H	124_T	1.007	0.59
75_T	87_D	1.006	0.59

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2r19A	2	0.8595	100	0.408	Contact Map	0.692
3my2A	1	0.8649	98.2	0.83	Contact Map	0.519
4ixqO	2	0.8432	17.1	0.947	Contact Map	0.053
1s5lU	2	0.6919	10.7	0.952	Contact Map	0.017
2nocA	1	0.4865	7.4	0.955	Contact Map	0.041
1dbgA	1	0.8703	6.4	0.956	Contact Map	0.233
1y0gA	4	0.8324	5.8	0.957	Contact Map	0.073
3ua0A	2	0.5892	5.5	0.958	Contact Map	0
4bbwA	1	0.9405	4.9	0.959	Contact Map	0.029
2jnaA	2	0.5351	4.2	0.96	Contact Map	0.03

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.6347 seconds.