OPENSEQ.org - ILVM - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

ILVM - Acetolactate synthase isozyme 2 small subunit

UniProt:	P0ADG1	Sequence MMQHQVNVSARFNPETLERVLRVVRHRGFHVCSMNMAAASDAQNINIELTVASPRSVDLLFSQLNKLVDVAHVAICQSTTTSQQIRA	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG10501
Length:	87 (85)
Sequences:	93
Seq/Len:	1.09

ILVM
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
17_L	31_V	3.039	1.00
22_R	26_H	2.146	0.98
31_V	34_M	2.034	0.97
62_S	70_V	1.688	0.88
6_V	57_V	1.544	0.82
83_Q	87_A	1.46	0.76
4_H	34_M	1.451	0.76
4_H	64_L	1.445	0.75
10_A	48_E	1.407	0.72
14_P	36_M	1.345	0.68
33_S	50_T	1.34	0.67
4_H	62_S	1.329	0.66
79_T	86_R	1.321	0.66
14_P	55_R	1.312	0.65
79_T	83_Q	1.29	0.63
16_T	24_V	1.278	0.62
56_S	73_V	1.254	0.60
6_V	67_L	1.227	0.57
79_T	84_Q	1.202	0.55
12_F	48_E	1.174	0.52
15_E	47_I	1.161	0.51
82_S	87_A	1.16	0.51
17_L	55_R	1.153	0.50
9_S	33_S	1.152	0.50
61_F	68_V	1.142	0.49
22_R	29_F	1.141	0.49
70_V	77_Q	1.118	0.47
82_S	86_R	1.108	0.46
57_V	65_N	1.103	0.45
41_D	57_V	1.076	0.43
11_R	35_N	1.073	0.43
9_S	32_C	1.071	0.42
22_R	55_R	1.07	0.42
14_P	17_L	1.063	0.42
45_I	76_C	1.063	0.42
34_M	64_L	1.058	0.41
52_A	57_V	1.047	0.40
15_E	26_H	1.037	0.39
5_Q	43_Q	1.031	0.39
84_Q	87_A	1.028	0.38
26_H	29_F	1.02	0.38
39_A	49_L	1.013	0.37
53_S	73_V	1.01	0.37
78_S	86_R	1.006	0.36
3_Q	10_A	1.004	0.36

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2f1fA	2	1	98.6	0.707	Contact Map	0.246
2pc6A	4	1	98.6	0.708	Contact Map	0.193
2fgcA	1	1	98.4	0.725	Contact Map	0.062
2lvwA	2	0.9655	97.3	0.788	Contact Map	0.178
1zpvA	3	0.977	96.1	0.816	Contact Map	0.131
1y7pA	3	0.9655	93.8	0.839	Contact Map	0.243
2ko1A	2	0.9425	93.2	0.843	Contact Map	0.181
1u8sA	2	1	84.6	0.868	Contact Map	0.127
2jheA	4	0.931	80.8	0.873	Contact Map	0.26
3n0vA	4	0.9885	78.2	0.876	Contact Map	0.247

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 1.4662 seconds.