OPENSEQ.org - BFR - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

BFR - Bacterioferritin

UniProt:	P0ABD3	Sequence MKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIERILFLEGLPNLQDLGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVHDYVSRDMMIEILRDEEGHIDWLETELDLIQKMGLQNYLQAQIREEG	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG10113
Length:	158 (155)
Sequences:	827
Seq/Len:	5.34

BFR
Paralog alert: 0.23 [within 20: 0.06] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
57_R	122_E	3.348	1.00
84_E	88_R	3.115	1.00
4_D	111_V	2.258	1.00
82_D	85_E	2.209	1.00
107_Y	111_V	2.111	1.00
98_A	102_R	2.048	1.00
32_F	86_M	2.023	1.00
78_N	92_A	1.994	1.00
6_K	9_N	1.937	1.00
88_R	92_A	1.928	1.00
39_R	153_Q	1.926	1.00
84_E	146_L	1.855	1.00
37_L	150_L	1.817	1.00
98_A	131_I	1.757	1.00
16_G	20_V	1.75	1.00
104_A	120_M	1.738	1.00
49_I	52_M	1.651	0.99
144_M	154_I	1.641	0.99
91_L	135_E	1.623	0.99
6_K	111_V	1.605	0.99
30_R	56_D	1.59	0.99
84_E	142_Q	1.568	0.99
12_N	67_G	1.552	0.99
34_N	66_E	1.546	0.99
7_V	108_A	1.524	0.99
59_I	71_L	1.519	0.99
42_D	46_H	1.508	0.99
58_Y	119_M	1.492	0.99
51_E	130_H	1.49	0.99
33_K	60_E	1.482	0.99
50_D	126_D	1.454	0.98
50_D	53_K	1.426	0.98
141_I	146_L	1.422	0.98
51_E	54_H	1.42	0.98
99_K	103_E	1.351	0.97
10_Y	107_Y	1.351	0.97
15_L	62_I	1.342	0.97
37_L	143_K	1.32	0.96
51_E	94_E	1.298	0.96
109_D	117_R	1.29	0.96
98_A	127_E	1.286	0.96
139_D	143_K	1.275	0.95
118_D	121_I	1.272	0.95
96_D	100_N	1.258	0.95
31_M	63_L	1.256	0.95
4_D	107_Y	1.252	0.95
22_I	52_M	1.249	0.95
5_T	9_N	1.23	0.94
84_E	138_L	1.226	0.94
62_I	67_G	1.217	0.94
43_V	46_H	1.21	0.93
54_H	127_E	1.205	0.93
132_D	136_T	1.204	0.93
78_N	96_D	1.202	0.93
30_R	59_I	1.196	0.93
31_M	80_G	1.18	0.92
127_E	130_H	1.153	0.91
34_N	64_F	1.131	0.90
17_N	100_N	1.118	0.89
18_E	127_E	1.118	0.89
48_S	52_M	1.116	0.89
16_G	73_D	1.113	0.89
58_Y	116_S	1.108	0.89
2_K	66_E	1.097	0.88
113_D	116_S	1.093	0.88
13_K	100_N	1.092	0.88
6_K	107_Y	1.061	0.86
14_L	101_L	1.056	0.85
144_M	150_L	1.055	0.85
106_G	110_S	1.05	0.85
16_G	86_M	1.049	0.85
38_K	42_D	1.041	0.84
83_V	150_L	1.04	0.84
148_N	151_Q	1.039	0.84
10_Y	100_N	1.036	0.84
21_A	54_H	1.031	0.83
105_I	120_M	1.028	0.83
18_E	54_H	1.02	0.82
10_Y	104_A	1.015	0.82
54_H	130_H	1.014	0.82
49_I	56_D	1.013	0.82
50_D	54_H	1.012	0.82

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2v8tA	2	0.981	100	0.43	Contact Map	0.484
2y3qA	12	1	100	0.435	Contact Map	0.771
1o9iA	6	0.962	100	0.444	Contact Map	0.657
2fkzA	8	0.981	100	0.45	Contact Map	0.779
3fvbA	2	1	100	0.451	Contact Map	0.678
3r2kA	1	0.9684	100	0.452	Contact Map	0.568
3gvyA	3	1	100	0.455	Contact Map	0.799
4am5A	2	1	100	0.461	Contact Map	0.744
1jgcA	3	1	100	0.463	Contact Map	0.694
3vnxA	1	1	100	0.464	Contact Map	0.588

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.5841 seconds.