OPENSEQ.org - SSRP - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

SSRP - SsrA-binding protein

UniProt:	P0A832	Sequence MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRDGEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAHR	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG11782
Length:	160 (149)
Sequences:	1510
Seq/Len:	10.13

SSRP
Paralog alert: 0.01 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
144_E	148_Q	2.992	1.00
26_I	114_L	2.894	1.00
54_S	68_A	2.878	1.00
27_E	109_Y	2.804	1.00
65_L	68_A	2.74	1.00
29_E	126_K	2.351	1.00
35_A	89_K	2.343	1.00
140_S	144_E	2.336	1.00
63_A	97_L	2.321	1.00
148_Q	152_A	2.309	1.00
49_A	116_L	2.276	1.00
62_E	89_K	2.271	1.00
63_A	92_L	2.222	1.00
26_I	128_G	2.148	1.00
41_V	118_W	2.141	1.00
94_Q	98_D	2.12	1.00
44_L	49_A	2.06	1.00
115_S	126_K	1.988	1.00
26_I	130_A	1.923	1.00
65_L	125_V	1.905	1.00
56_V	111_V	1.857	1.00
56_V	63_A	1.842	1.00
19_R	23_E	1.84	1.00
147_W	151_K	1.82	1.00
58_L	63_A	1.819	1.00
41_V	123_C	1.803	1.00
66_F	87_T	1.797	1.00
58_L	97_L	1.759	1.00
27_E	131_K	1.758	1.00
142_I	146_E	1.728	1.00
56_V	127_I	1.696	1.00
142_I	145_R	1.668	1.00
21_R	29_E	1.658	1.00
147_W	154_I	1.635	1.00
14_I	118_W	1.63	1.00
57_L	66_F	1.625	1.00
32_A	92_L	1.599	1.00
133_K	141_D	1.592	1.00
31_E	117_Y	1.592	1.00
151_K	154_I	1.542	1.00
25_F	131_K	1.48	1.00
69_N	85_T	1.476	1.00
116_L	123_C	1.456	1.00
16_L	21_R	1.456	1.00
34_L	125_V	1.423	1.00
103_R	129_V	1.398	0.99
51_I	68_A	1.374	0.99
93_N	122_W	1.337	0.99
39_W	82_C	1.318	0.99
111_V	127_I	1.314	0.99
101_Y	105_N	1.298	0.99
30_F	100_L	1.285	0.99
39_W	81_V	1.284	0.99
58_L	111_V	1.268	0.99
103_R	106_R	1.243	0.98
141_D	144_E	1.238	0.98
16_L	115_S	1.236	0.98
41_V	44_L	1.218	0.98
59_R	87_T	1.215	0.98
46_A	74_A	1.203	0.98
92_L	97_L	1.152	0.97
39_W	77_S	1.126	0.97
25_F	141_D	1.123	0.97
143_K	147_W	1.119	0.96
116_L	125_V	1.109	0.96
14_I	123_C	1.108	0.96
30_F	92_L	1.104	0.96
26_I	29_E	1.094	0.96
50_N	53_D	1.092	0.96
104_V	111_V	1.091	0.96
31_E	93_N	1.089	0.96
72_P	83_D	1.071	0.95
98_D	102_G	1.051	0.94
55_Y	66_F	1.05	0.94
114_L	128_G	1.049	0.94
140_S	143_K	1.044	0.94
44_L	118_W	1.043	0.94
39_W	76_A	1.028	0.94
44_L	70_I	1.01	0.93
59_R	66_F	1.002	0.92

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1p6vA	2	0.9625	100	0.029	Contact Map	0.879
1j1hA	1	0.8938	100	0.041	Contact Map	0.568
1wjxA	1	0.7562	100	0.182	Contact Map	0.772
3vviA	8	0.1313	2.2	0.969	Contact Map	0.971
3zy1A	1	0.2625	1.8	0.971	Contact Map	0.346
2wqiA	4	0.2938	1.7	0.971	Contact Map	0.257
4j8cA	2	0.2875	1.7	0.971	Contact Map	0.685
1ri9A	1	0.3937	1.6	0.972	Contact Map	0
2l5rA	1	0.1437	1.5	0.972	Contact Map	0.359
3j3aI	1	0.4375	1.4	0.972	Contact Map	0.142

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.6578 seconds.