OPENSEQ.org - DINJ - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

DINJ - Antitoxin DinJ

UniProt:	Q47150	Sequence MAANAFVRARIDEDLKNQAADVLAGMGLTISDLVRITLTKVAREKALPFDLREPNQLTIQSIKNSEAGIDVHKAKDADDLFDKLGI	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13142
Length:	86 (85)
Sequences:	538
Seq/Len:	6.33

DINJ
Paralog alert: 0.14 [within 20: 0.03] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
22_V	42_A	2.57	1.00
55_N	58_T	2.558	1.00
15_L	42_A	2.546	1.00
77_A	81_F	2.363	1.00
23_L	41_V	2.339	1.00
33_L	37_T	2.048	1.00
19_A	23_L	1.978	1.00
11_I	38_L	1.902	1.00
19_A	38_L	1.81	1.00
8_R	35_R	1.684	1.00
64_N	69_I	1.677	1.00
65_S	68_G	1.669	1.00
29_T	32_D	1.625	1.00
58_T	61_S	1.597	1.00
40_K	44_E	1.59	0.99
63_K	67_A	1.485	0.99
34_V	38_L	1.454	0.99
61_S	64_N	1.434	0.99
35_R	39_T	1.402	0.98
46_A	52_R	1.385	0.98
22_V	26_M	1.364	0.98
22_V	46_A	1.313	0.97
26_M	53_E	1.257	0.96
25_G	53_E	1.239	0.96
47_L	51_L	1.209	0.95
30_I	38_L	1.172	0.94
29_T	47_L	1.153	0.93
40_K	51_L	1.146	0.93
13_E	17_N	1.145	0.93
22_V	41_V	1.127	0.92
72_H	83_K	1.1	0.91
4_N	13_E	1.073	0.90
62_I	65_S	1.07	0.89
75_K	78_D	1.062	0.89
77_A	85_G	1.023	0.86
54_P	58_T	1.023	0.86
78_D	81_F	1.022	0.86
26_M	46_A	1.015	0.86
36_I	43_R	1.01	0.85
10_R	16_K	1.008	0.85

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
4fxeA	3	0.8837	99.8	0.249	Contact Map	0.573
1bazA	4	0.5698	93	0.793	Contact Map	0.593
2k9iA	2	0.5814	88.5	0.814	Contact Map	0.456
1p94A	2	0.5349	88.2	0.815	Contact Map	0.63
2gpeA	4	0.5581	87.8	0.816	Contact Map	0.533
2ay0A	6	0.6744	86.5	0.82	Contact Map	0.558
2cpgA	3	0.5233	86.5	0.82	Contact Map	0.472
1nlaA	2	0.6744	79.7	0.833	Contact Map	0.409
2kelA	2	0.5465	77.7	0.836	Contact Map	0.611
2ba3A	2	0.4651	66.7	0.849	Contact Map	0.197

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0345 seconds.