OPENSEQ.org - ALLA - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

ALLA - Ureidoglycolate hydrolase

UniProt:	P77731	Sequence MKLQVLPLSQEAFSAYGDVIETQQRDFFHINNGLVERYHDLALVEILEQDCTLISINRAQPANLPLTIHELERHPLGTQAFIPMKGEVFVVVVALGDDKPDLSTLRAFITNGEQGVNYHRNVWHHPLFAWQRVTDFLTIDRGGSDNCDVESIPEQELCFA	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13615
Length:	160 (154)
Sequences:	322
Seq/Len:	2.09

ALLA
Paralog alert: 0.06 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
6_L	106_R	4.325	1.00
58_R	135_D	3.199	1.00
8_L	19_V	2.996	1.00
89_F	110_T	2.718	1.00
54_I	139_I	2.584	1.00
53_L	142_G	2.231	1.00
16_Y	106_R	1.832	0.98
40_D	51_C	1.722	0.97
71_L	107_A	1.711	0.97
125_H	128_F	1.662	0.96
57_N	138_T	1.653	0.96
59_A	127_L	1.629	0.95
52_T	94_A	1.607	0.95
140_D	146_N	1.559	0.94
91_V	110_T	1.548	0.93
16_Y	139_I	1.528	0.93
45_E	120_R	1.5	0.92
125_H	129_A	1.485	0.91
96_G	100_P	1.457	0.90
85_K	135_D	1.451	0.90
27_F	36_E	1.443	0.90
18_D	119_H	1.41	0.88
97_D	100_P	1.39	0.87
80_A	117_N	1.337	0.84
34_L	126_P	1.318	0.83
18_D	117_N	1.314	0.83
37_R	77_G	1.305	0.82
47_L	105_L	1.294	0.81
95_L	121_N	1.293	0.81
68_I	91_V	1.271	0.80
5_V	109_I	1.263	0.79
45_E	50_D	1.261	0.79
121_N	147_C	1.246	0.78
42_A	117_N	1.244	0.78
75_P	146_N	1.218	0.76
92_V	115_G	1.216	0.75
37_R	65_P	1.191	0.73
71_L	121_N	1.188	0.73
73_R	148_D	1.182	0.72
75_P	143_G	1.18	0.72
55_S	142_G	1.174	0.72
66_L	128_F	1.168	0.71
66_L	92_V	1.167	0.71
47_L	120_R	1.162	0.71
88_V	131_Q	1.159	0.70
82_I	137_L	1.159	0.70
34_L	71_L	1.155	0.70
105_L	147_C	1.143	0.69
105_L	121_N	1.129	0.67
44_V	139_I	1.127	0.67
44_V	54_I	1.121	0.67
141_R	146_N	1.109	0.65
28_F	147_C	1.092	0.64
84_M	137_L	1.091	0.64
77_G	140_D	1.086	0.63
39_H	42_A	1.085	0.63
25_R	139_I	1.063	0.61
8_L	110_T	1.043	0.58
28_F	32_N	1.042	0.58
96_G	99_K	1.04	0.58
10_Q	21_E	1.039	0.58
5_V	86_G	1.036	0.58
21_E	114_Q	1.029	0.57
30_I	141_R	1.023	0.56
77_G	127_L	1.02	0.56
90_V	152_I	1.019	0.56
30_I	77_G	1.016	0.55
89_F	136_F	1.008	0.55
61_P	142_G	1.005	0.54
121_N	148_D	1.004	0.54

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1xsqA	2	1	100	0.162	Contact Map	0.483
2bdrA	2	1	100	0.168	Contact Map	0.533
3d0jA	1	0.7812	59	0.938	Contact Map	0.449
1w74A	2	0.3063	5.1	0.963	Contact Map	0.07
3ejkA	1	0.9375	5.1	0.963	Contact Map	0.245
2pa7A	2	0.7812	4.7	0.964	Contact Map	0.341
1x82A	1	0.8875	4.4	0.965	Contact Map	0.19
4mcjA	10	0.4562	4	0.965	Contact Map	0.002
2y0oA	1	0.875	3.3	0.967	Contact Map	0.081
4g63A	1	0.475	2.8	0.968	Contact Map	0.065

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0091 seconds.